DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and mdh-1

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_504656.1 Gene:mdh-1 / 179041 WormBaseID:WBGene00018491 Length:336 Species:Caenorhabditis elegans


Alignment Length:311 Identity:79/311 - (25%)
Similarity:117/311 - (37%) Gaps:62/311 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LKVAVVGSVGGIG----------------QPLSLLLKHNPQISTLSLYDIKNTTGVGVDLSH--I 74
            |:|.|.|:.|.||                ||:.|:|...||.|.:       ..||..:|..  :
 Worm     5 LRVLVTGAAGQIGYSIVIRIADGTVFGKEQPVELVLLDVPQCSNI-------LEGVVFELQDCAL 62

  Fly    75 NTRASVCPFEGKNGLKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVC-PGA 138
            .|..||.....:   |.|....|...:...:||:.||:|:||:..|..:......|.:|.. |..
 Worm    63 PTLFSVVAVTDE---KSAFTGIDYAFLVGAMPRREGMERKDLLAANVKIFKSQGKALAEYAKPTT 124

  Fly   139 MLAFITNPINVIVPIVATILKAKGTYDPNRLFGVTTLDVVRAQTFVA-----DILNVDPQKVNIP 198
            .:..:.||.|....|.|..  |.|.........:|.||..||...:|     .|.||.    |:.
 Worm   125 KVIVVGNPANTNAFIAAKY--AAGKIPAKNFSAMTRLDHNRALAQLALKTGTTIGNVK----NVI 183

  Fly   199 VIGGHTGRTILPILSQCDPPFKGTDKEREA-----------LIQRIQNAGTEVVNAKDGLGSATL 252
            :.|.|:| |..|.::.......||:.:..|           .|..:|..|..::. |..|.|| :
 Worm   184 IWGNHSG-TQFPDVTHATVNKNGTETDAYAAVGDNAFLQGPFIATVQKRGGVIIE-KRKLSSA-M 245

  Fly   253 SMAFAATQFVSSLIKGIKGSKDECIVECAYVESD----VTEAQFFATPLIL 299
            |.|.||...:.....|.|..:   .|..| |.||    :.:...|:.|:.:
 Worm   246 SAAKAACDHIHDWHFGTKAGQ---FVSMA-VPSDGSYGIPQGLIFSFPVTI 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 79/311 (25%)
MDH_euk_gproteo 29..345 CDD:130833 78/310 (25%)
mdh-1NP_504656.1 PRK05442 1..325 CDD:235468 79/311 (25%)
MDH_cytoplasmic_cytosolic 3..328 CDD:133421 79/311 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S410
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.