DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and ldh-1

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001343759.1 Gene:ldh-1 / 174798 WormBaseID:WBGene00002262 Length:336 Species:Caenorhabditis elegans


Alignment Length:347 Identity:80/347 - (23%)
Similarity:138/347 - (39%) Gaps:76/347 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDI--KNTTGVGVDLSHINTRASVCPFEGKNGLKK 91
            ||.||| ||.:|...:..:......:.|.|.|:  ....|..:||.|           |....:.
 Worm    25 KVTVVG-VGQVGMACAYSILQQNLANELCLVDVVADKLKGEMMDLQH-----------GLAFTRH 77

  Fly    92 AMDKAD----------IVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNP 146
            ...|||          :.|:.||..::.|..|..||..|..:...:.....:..|...:..::||
 Worm    78 CTVKADTDYSITAGSKLCVVTAGARQREGETRLSLVQRNVEIFKGIIPQLVKYSPDTCILVVSNP 142

  Fly   147 INVIVPIVATILKAKGTYDPNRLFGV-TTLDVVRAQTFVADILNVDPQKVNIPVIGGH------- 203
            ::|:..:.   .|..| ....|:||. |.||..|.:..:::.||:.|...:..:||.|       
 Worm   143 VDVLTYVT---WKLSG-LPRERVFGSGTNLDSARFRFLLSEKLNIAPSSCHGWIIGEHGDSSVAV 203

  Fly   204 -TGRTILPI-LSQCDPPF-KGTDKER-EALI-QRIQNAGTEVVNAKD------GLGSATLSMA-F 256
             :|..:..: |.:..|.. :.||.|. ||.| :::.::..|::..|.      ||..|.::.. |
 Worm   204 WSGVNVAGVTLHEIKPDIGEKTDNEHWEAEIHKKVVDSAYEIIKLKGYTSWAIGLSVAKIAQGIF 268

  Fly   257 AATQFVSSL---IKGIKGSKDECIVECAYVESDVTEAQFFATPLILGPQG----VKENTGLPDLD 314
            :.::.|.:|   :||..|..|:.               :.:.|::||..|    ||:     .|.
 Worm   269 SNSRNVFALSTNVKGFHGINDDV---------------YLSLPVVLGSAGLTHVVKQ-----QLT 313

  Fly   315 DEERKALNGMLPILKESIAKGI 336
            :.|.:.|:.....|.| :..||
 Worm   314 EAEVQKLHNSAKALLE-VQNGI 334

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 80/347 (23%)
MDH_euk_gproteo 29..345 CDD:130833 80/347 (23%)
ldh-1NP_001343759.1 LDH_1 36..333 CDD:133429 70/332 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.