DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and Ldhb

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001303251.1 Gene:Ldhb / 16832 MGIID:96763 Length:341 Species:Mus musculus


Alignment Length:347 Identity:79/347 - (22%)
Similarity:138/347 - (39%) Gaps:84/347 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDI--KNTTGVGVDLSHINTRASVCPFEGKNGLKK 91
            |:.||| ||.:|...::.:........|:|.|:  ....|..:||.|           |...|:.
Mouse    23 KITVVG-VGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQH-----------GSLFLQT 75

  Fly    92 AMDKAD----------IVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNP 146
            ....||          |||:.||:.::.|..|.:||..|.:|...:.....:..|...:..::||
Mouse    76 PKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCTIIVVSNP 140

  Fly   147 INVIVPIVATILKAKGTYDPNRLFGV---------TTLDVVRAQTFVADILNVDPQKVNIPVIGG 202
            ::::            ||...:|.|:         ..||..|.:..:|:.|.:.|...:..::|.
Mouse   141 VDIL------------TYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGE 193

  Fly   203 H--------TGRTILPILSQCDPPFKGTDKERE---ALIQRIQNAGTEVVNAKD------GLGSA 250
            |        :|..:..:..|...|..|||.:.|   .:.:.:.::..||:..|.      ||..|
Mouse   194 HGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVDSAYEVIKLKGYTNWAIGLSVA 258

  Fly   251 TL--SMAFAATQF--VSSLIKGIKGSKDECIVECAYVESDVTEAQFFATPLILGPQGVKENTGLP 311
            .|  ||....::.  ||:::||:.|           :|::|    |.:.|.||..:|:.......
Mouse   259 DLIESMLKNLSRIHPVSTMVKGMYG-----------IENEV----FLSLPCILNARGLTSVINQK 308

  Fly   312 DLDDEE---RKALNGMLPILKE 330
            ..|||.   ||:.:.:..|.|:
Mouse   309 LKDDEVAQLRKSADTLWDIQKD 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 79/347 (23%)
MDH_euk_gproteo 29..345 CDD:130833 79/347 (23%)
LdhbNP_001303251.1 LDH_1 20..330 CDD:133429 78/345 (23%)
L-LDH-NAD 26..326 CDD:273796 76/338 (22%)
PTS1 339..341
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.