DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and Ldha

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001129541.2 Gene:Ldha / 16828 MGIID:96759 Length:361 Species:Mus musculus


Alignment Length:340 Identity:78/340 - (22%)
Similarity:139/340 - (40%) Gaps:70/340 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDI--KNTTGVGVDLSHINTRASVCPFEGKNGLK- 90
            |:.||| ||.:|...::.:........|:|.|:  ....|..:||.|           |...|| 
Mouse    51 KITVVG-VGAVGMACAISILMKDLADELALVDVMEDKLKGEMMDLQH-----------GSLFLKT 103

  Fly    91 -KAMDKAD--------IVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNP 146
             |.:...|        :|:|.||..::.|..|.:||..|.::...:.....:..|...|..::||
Mouse   104 PKIVSSKDYCVTANSKLVIITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKYSPHCKLLIVSNP 168

  Fly   147 INVIVPIVATILKAKGTYDPNRLFGV-TTLDVVRAQTFVADILNVDPQKVNIPVIGGHTGRTILP 210
            ::::..:.   .|..| :..||:.|. ..||..|.:..:.:.|.|.....:..|:|.| |.:.:|
Mouse   169 VDILTYVA---WKISG-FPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWVLGEH-GDSSVP 228

  Fly   211 ILSQCD---------PPFKGTDKERE---ALIQRIQNAGTEVVNAKD------GLGSATLSMA-- 255
            :.|..:         .|..|||.::|   .:.:::.::..||:..|.      ||..|.|:.:  
Mouse   229 VWSGVNVAGVSLKSLNPELGTDADKEQWKEVHKQVVDSAYEVIKLKGYTSWAIGLSVADLAESIM 293

  Fly   256 --FAATQFVSSLIKGIKGSKDECIVECAYVESDVTEAQFFATPLILGPQGVKENTGLPDLDDEE- 317
              ......:|::|||:.|               :.|..|.:.|.|||..|:.:...:....:|| 
Mouse   294 KNLRRVHPISTMIKGLYG---------------INEDVFLSVPCILGQNGISDVVKVTLTPEEEA 343

  Fly   318 --RKALNGMLPILKE 330
              :|:.:.:..|.||
Mouse   344 RLKKSADTLWGIQKE 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 78/340 (23%)
MDH_euk_gproteo 29..345 CDD:130833 78/340 (23%)
LdhaNP_001129541.2 LDH_1 48..358 CDD:133429 76/338 (22%)
L-LDH-NAD 54..353 CDD:273796 74/330 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.