DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and MDH1B

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_001034934.1 Gene:MDH1B / 130752 HGNCID:17836 Length:518 Species:Homo sapiens


Alignment Length:324 Identity:60/324 - (18%)
Similarity:109/324 - (33%) Gaps:68/324 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 LKVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDIKNTTGVGVDL-SHINTRASVCPFEGKNGLKK 91
            :.:...|.|.|:...:|:.|..|.|...    .:|:......|| |.:....|:|     ..:::
Human   148 IPILTSGEVFGMHTEISITLFDNKQAEE----HLKSLVVETQDLASPVLRSVSIC-----TKVEE 203

  Fly    92 AMDKADIVVIPAGLPRKPGMKRED--------------LVDVNASVACEVAFAASEVCPGAMLAF 142
            |..:|.::|:......|.....||              |::.||..:..|............:..
Human   204 AFRQAHVIVVLDDSTNKEVFTLEDCLRSRVPLCRLYGYLIEKNAHESVRVIVGGRTFVNLKTVLL 268

  Fly   143 ITNPINVIVPIVATILKAKGTYDPNRLFGVTTLDVVRAQTFVADIL---------NVDPQKVNI- 197
            :.....:...|:|..|..:|     ....:....:..|.:::.|::         .||.:|..: 
Human   269 MRYAPRIAHNIIAVALGVEG-----EAKAILARKLKTAPSYIKDVIIWGNISGNNYVDLRKTRVY 328

  Fly   198 ---PVIGG--HTGRTILPILSQCDPPFKGTDKEREALIQRIQNAGTEVVNAKDGLGSATLSMAFA 257
               ..|.|  |..|.:|.::...:    ...:|..|:::.:...|.:.    .|:        .|
Human   329 RYESAIWGPLHYSRPVLNLIFDSE----WVKREFVAILKNLTTTGRQF----GGI--------LA 377

  Fly   258 ATQFVSSLIKGIKGSKDECIVECAYVESDVTEAQFFATPLILGPQGVKENTG----LPDLDDEE 317
            |....::|.....||....||....    ::|.||.....|:....||...|    |.||.|.|
Human   378 AHSIATTLKYWYHGSPPGEIVSLGI----LSEGQFGIPKGIVFSMPVKFENGTWVVLTDLKDVE 437

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 60/324 (19%)
MDH_euk_gproteo 29..345 CDD:130833 60/323 (19%)
MDH1BNP_001034934.1 MDH_like 9..459 CDD:133431 60/324 (19%)
MalateDH-SF1 131..457 CDD:130820 60/324 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.