DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10749 and Ldhal6b

DIOPT Version :9

Sequence 1:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_780558.1 Gene:Ldhal6b / 106557 MGIID:2146830 Length:382 Species:Mus musculus


Alignment Length:363 Identity:72/363 - (19%)
Similarity:142/363 - (39%) Gaps:71/363 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLSHVGNLPPKVQQLGYINRGLKVAVVGSVGGIGQPLSLLLKHNPQISTLSLYD--IKNTTGVGV 69
            |:.|:.:..|.:..        ||::||: |.:|...::.:........|:|.|  .:...|..:
Mouse    58 LIQHISSEEPVLHN--------KVSIVGT-GSVGMACAIGIIAKGLTDELALVDNNEEKMKGETM 113

  Fly    70 DLSH----INTRASVCPFEGKNGLKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFA 130
            ||.|    :.....||..:     .:....:::|:|.||..::....|.:||..|.::...:...
Mouse   114 DLQHGSVFMKMPNIVCSKD-----FRVTANSEVVIITAGARQEKNETRLNLVQRNVTIFKAMVAE 173

  Fly   131 ASEVCPGAMLAFITNPINVIVPIVATILKAKGTYDPNRLFGV-TTLDVVRAQTFVADILNVDPQK 194
            ..:..|...:..::||::::..:.   .|..| :..||:.|. ..||..|.:..:...|.:..:.
Mouse   174 IIKHSPRCKIIVVSNPVDILTFVT---WKLSG-FPKNRIIGSGCNLDTARFRYMLGQRLGIHSES 234

  Fly   195 VNIPVIGGHTGRTILPILSQCD---PPFK------GTDKEREA---LIQRIQNAGTEVVNAKDGL 247
            .:..|:|.| |.:.:|:.|..:   .|.:      ||.|:.|.   :.:.:..:...::..|   
Mouse   235 CHGWVLGEH-GDSSVPVWSGVNIAGVPLRELNSAIGTSKDPEKWGDVHKEVIASAYNIIKMK--- 295

  Fly   248 GSATLSMAFAATQFVSSLIK-------------GIKGSKDECIVECAYVESDVTEAQFFATPLIL 299
            |..:.::..:.|....|::|             |:.|.|:|.               |.:.|.||
Mouse   296 GYTSWAIGLSVTDIAESILKNLRKTHPVTTKIQGLYGIKEEV---------------FLSVPCIL 345

  Fly   300 GPQGVKENTGLPDLDDEERKALNGMLPILKESIAKGIK 337
            |..|:.:...:.....||.:.:.....|.|  |.|.||
Mouse   346 GESGISDIIKVKLSPTEEAQMVKSAETIWK--IQKDIK 381

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 67/340 (20%)
MDH_euk_gproteo 29..345 CDD:130833 69/341 (20%)
Ldhal6bNP_780558.1 LDH_1 70..379 CDD:133429 66/347 (19%)
L-LDH-NAD 75..375 CDD:273796 62/328 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.