DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and mMDH1

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_564625.1 Gene:mMDH1 / 841757 AraportID:AT1G53240 Length:341 Species:Arabidopsis thaliana


Alignment Length:309 Identity:150/309 - (48%)
Similarity:210/309 - (67%) Gaps:0/309 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVAVVGAGGGIGQPLSLLLRRCPGIDELALHDLSEMKGIATDLSHISQTGKVIGFTGEKELESAV 88
            |||::||.|||||||:||::..|.:..|:|:|::...|:|.|:.||:...:|:|:.|:..|..|:
plant    31 KVAILGAAGGIGQPLALLMKLNPLVSSLSLYDIANTPGVAADVGHINTRSEVVGYMGDDNLAKAL 95

  Fly    89 SGADVVVVAAGMPRLPGMQRDHLMAANGNVAVKVATAISNASPRAHLAFITNPVNMIVPAAAEVL 153
            .|||:|::.||:||.|||.||.|...|..:...:.|||:...|.|.:..|:||||..||.|||:.
plant    96 EGADLVIIPAGVPRKPGMTRDDLFNINAGIVKNLCTAIAKYCPHALINMISNPVNSTVPIAAEIF 160

  Fly   154 MAHGTFDSRRLFGITTLDVVRSKKFIGDSMNISPDDVNIPVIGGHAGITILPLISQCQPIYRCDL 218
            ...|.:|.::|||:|||||||::.|.....|:...:||:||||||||:|||||.||..|......
plant   161 KKAGMYDEKKLFGVTTLDVVRARTFYAGKANVPVAEVNVPVIGGHAGVTILPLFSQATPQANLSS 225

  Fly   219 QEIQNLTHRIQEAGTEVVNAKAGKGSATLSMAYAGATFVNSLLRGIAGQDGLIECAFVASKLTDA 283
            ..:..||.|.|:.|||||.|||||||||||||||||.|.::.|:|:.|...:|||::|.|.:|:.
plant   226 DILTALTKRTQDGGTEVVEAKAGKGSATLSMAYAGALFADACLKGLNGVPDVIECSYVQSTITEL 290

  Fly   284 PFFASPLELGKDGIKRYIPLPQMSDYEKEALEKLLPILRQNADEGVNFA 332
            |||||.:.|||:|::..:.|..:||:|||.||.|.|.|:.:.::||.||
plant   291 PFFASKVRLGKNGVEEVLDLGPLSDFEKEGLEALKPELKSSIEKGVKFA 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 141/297 (47%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 139/295 (47%)
mMDH1NP_564625.1 PLN00106 12..334 CDD:215058 146/302 (48%)
MDH_glyoxysomal_mitochondrial 31..339 CDD:133422 148/307 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 185 1.000 Domainoid score I994
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976445at2759
OrthoFinder 1 1.000 - - FOG0001716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11540
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1106
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.880

Return to query results.
Submit another query.