DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and PMDH2

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001119199.1 Gene:PMDH2 / 830825 AraportID:AT5G09660 Length:363 Species:Arabidopsis thaliana


Alignment Length:258 Identity:127/258 - (49%)
Similarity:177/258 - (68%) Gaps:2/258 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVAVVGAGGGIGQPLSLLLRRCPGIDELALHDLSEMKGIATDLSHISQTGKVI-GFTGEKELESA 87
            |||::||.|||||.||||::..|.:..|.|:|:....|:..|:||: .||.|: ||.|.|:||.|
plant    44 KVAILGAAGGIGQSLSLLMKMNPLVSLLHLYDVVNAPGVTADVSHM-DTGAVVRGFLGAKQLEDA 107

  Fly    88 VSGADVVVVAAGMPRLPGMQRDHLMAANGNVAVKVATAISNASPRAHLAFITNPVNMIVPAAAEV 152
            ::|.|:|::.||:||.|||.||.|...|..:...:...::...|.|.:..|:||||..||.||||
plant   108 LTGMDLVIIPAGIPRKPGMTRDDLFKINAGIVKTLCEGVAKCCPNAIVNLISNPVNSTVPIAAEV 172

  Fly   153 LMAHGTFDSRRLFGITTLDVVRSKKFIGDSMNISPDDVNIPVIGGHAGITILPLISQCQPIYRCD 217
            ....||:|.::|.|:|||||.|:..|:.:.:.:.|.:|::||:|||||:|||||:||.:|.....
plant   173 FKKAGTYDPKKLLGVTTLDVARANTFVAEVLGLDPREVDVPVVGGHAGVTILPLLSQVKPPSSFT 237

  Fly   218 LQEIQNLTHRIQEAGTEVVNAKAGKGSATLSMAYAGATFVNSLLRGIAGQDGLIECAFVASKL 280
            .|||:.||:|||..|||||.||||.||||||||||.|.|.::.|||:.|...::||:||||::
plant   238 PQEIEYLTNRIQNGGTEVVEAKAGAGSATLSMAYAAAKFADACLRGLRGDANVVECSFVASQV 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 118/246 (48%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 118/246 (48%)
PMDH2NP_001119199.1 PLN00106 31..300 CDD:215058 127/256 (50%)
MDH_glyoxysomal_mitochondrial 43..301 CDD:133422 127/258 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 185 1.000 Domainoid score I994
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976445at2759
OrthoFinder 1 1.000 - - FOG0001716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11540
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.