DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and AT3G53910

DIOPT Version :10

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_190959.1 Gene:AT3G53910 / 824558 AraportID:AT3G53910 Length:108 Species:Arabidopsis thaliana


Alignment Length:81 Identity:26/81 - (32%)
Similarity:50/81 - (61%) Gaps:2/81 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 YAGATFVNSLLRGIAGQDGLIECAFVASKLTDAPFFASPLELGKDGIKRYI--PLPQMSDYEKEA 313
            ||..:|:.||:|.:.|.|.:.:.|||||.:|:.|:||:..::||..|:..|  .|..::.||:.|
plant     9 YAMISFLKSLIRALDGDDDVFDFAFVASSVTELPYFATRTKIGKKRIEEVIDSDLQGLAKYEERA 73

  Fly   314 LEKLLPILRQNADEGV 329
            ::.:.|.::...::.:
plant    74 IKAIKPRVKVTIEKDI 89

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 26/81 (32%)
AT3G53910NP_190959.1 PLN00106 <9..87 CDD:215058 26/77 (34%)

Return to query results.
Submit another query.