DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and PMDH1

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_179863.1 Gene:PMDH1 / 816808 AraportID:AT2G22780 Length:354 Species:Arabidopsis thaliana


Alignment Length:310 Identity:147/310 - (47%)
Similarity:208/310 - (67%) Gaps:0/310 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVAVVGAGGGIGQPLSLLLRRCPGIDELALHDLSEMKGIATDLSHISQTGKVIGFTGEKELESAV 88
            |||::||.|||||||::|::..|.:..|.|:|::...|:..|:||:..:..|.||.|:.:||.|:
plant    44 KVAILGAAGGIGQPLAMLMKMNPLVSVLHLYDVANAPGVTADISHMDTSAVVRGFLGQPQLEEAL 108

  Fly    89 SGADVVVVAAGMPRLPGMQRDHLMAANGNVAVKVATAISNASPRAHLAFITNPVNMIVPAAAEVL 153
            :|.|:|::.||:||.|||.||.|...|..:...::.||:...|:|.:..|:||||..||.||||.
plant   109 TGMDLVIIPAGVPRKPGMTRDDLFNINAGIVRTLSEAIAKCCPKAIVNIISNPVNSTVPIAAEVF 173

  Fly   154 MAHGTFDSRRLFGITTLDVVRSKKFIGDSMNISPDDVNIPVIGGHAGITILPLISQCQPIYRCDL 218
            ...||||.::|.|:|.|||||:..|:.:.|::.|.:|.:||:|||||:|||||:||.:|......
plant   174 KKAGTFDPKKLMGVTMLDVVRANTFVAEVMSLDPREVEVPVVGGHAGVTILPLLSQVKPPCSFTQ 238

  Fly   219 QEIQNLTHRIQEAGTEVVNAKAGKGSATLSMAYAGATFVNSLLRGIAGQDGLIECAFVASKLTDA 283
            :||:.||.|||..|||||.||||.||||||||||...|.::.|||:.|...::|||:|||.:|:.
plant   239 KEIEYLTDRIQNGGTEVVEAKAGAGSATLSMAYAAVEFADACLRGLRGDANIVECAYVASHVTEL 303

  Fly   284 PFFASPLELGKDGIKRYIPLPQMSDYEKEALEKLLPILRQNADEGVNFAK 333
            |||||.:.||:.||.....|..:::||:..|||....|..:..:||.|||
plant   304 PFFASKVRLGRCGIDEVYGLGPLNEYERMGLEKAKKELSVSIHKGVTFAK 353

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 136/296 (46%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 135/295 (46%)
PMDH1NP_179863.1 PLN00106 33..347 CDD:215058 142/302 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 185 1.000 Domainoid score I994
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D976445at2759
OrthoFinder 1 1.000 - - FOG0001716
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11540
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1106
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.880

Return to query results.
Submit another query.