powered by:
Protein Alignment CG10748 and mdh1b
DIOPT Version :9
Sequence 1: | NP_648615.1 |
Gene: | CG10748 / 39469 |
FlyBaseID: | FBgn0036327 |
Length: | 349 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_009303919.1 |
Gene: | mdh1b / 767794 |
ZFINID: | ZDB-GENE-060929-384 |
Length: | 471 |
Species: | Danio rerio |
Alignment Length: | 47 |
Identity: | 15/47 - (31%) |
Similarity: | 23/47 - (48%) |
Gaps: | 7/47 - (14%) |
- Green bases have known domain annotations that are detailed below.
Fly 275 FVASKLTDAPFFASPLELGKDGIKRYIP------LPQMSDYEKEALE 315
||.:...|.|::|. .||..|.::|.:| :|...|..|:.||
Zfish 4 FVLAGKADCPYYAK-AELLADVLQRNLPDFHIHKIPVPPDDWKKWLE 49
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0039 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.