DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and Uevld

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:XP_008757683.1 Gene:Uevld / 691172 RGDID:1587416 Length:470 Species:Rattus norvegicus


Alignment Length:313 Identity:69/313 - (22%)
Similarity:116/313 - (37%) Gaps:62/313 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVAVVGAGG-GIGQPLSLLLRRCPGI-DELALHDLSEMKGIAT-DLSHISQTGKVIGFTGEKELE 85
            |:.|||:|. ||...|::..:   || |:|.|.|||:.....| ||...:.....|    .|:|.
  Rat   184 KITVVGSGDLGIACTLAISAK---GIADKLLLLDLSDGTNQGTMDLDIFNLPNVEI----SKDLS 241

  Fly    86 SAVSGADVVVVAAGMPRLPGMQRDHLMAANGNVAV--KVATAISNASPRAHLAFITNPVNMIVPA 148
            ::.....|:..|..:    |....:|.|...||.:  .:..|:.:.|..|.|...:.||.::   
  Rat   242 ASAHSKVVIFTANSL----GGSESYLHAVQSNVDMFRALVPALGHYSQHAVLLVASQPVEIM--- 299

  Fly   149 AAEVLMAHGTFDSRRLFGI-TTLDVVRSKKFIGDSMNISPDDVNIPVIG-----------GHAGI 201
             :.|.....||.:.|:.|| ..||..|.:..|...:........:.|:|           |..|:
  Rat   300 -SYVTWKLSTFPAARVMGIGCNLDSQRLQYIISSVLKAQTSGKEVWVVGEQGENKVCSWSGQDGV 363

  Fly   202 ----TILPLISQCQPIYRCDLQEIQNLTHRIQEAGTEVVNAKAGKGSATLSMAYAGATFVNSLLR 262
                :...|.|:...:.:...|...::...:.:....::|.|....|            |::|.:
  Rat   364 MSPSSQAQLSSRAMGLLKVKGQRSWSVGLSVADLLDTIINNKKKVHS------------VSTLAK 416

  Fly   263 GIAGQDGLIECAFVASKLTDAPFFASPLELGKDGIKRYIPLPQMSDYEKEALE 315
            |..|.|..:             |.:.|..||..|:...:. ....|...|||:
  Rat   417 GYYGLDNEV-------------FLSLPCILGTSGVSEVLK-TAAEDAVTEALQ 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 62/300 (21%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 62/300 (21%)
UevldXP_008757683.1 UEV 21..138 CDD:283415
NADB_Rossmann 180..467 CDD:304358 69/313 (22%)
L-LDH-NAD 187..461 CDD:273796 68/310 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.