DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and UEVLD

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001035787.1 Gene:UEVLD / 55293 HGNCID:30866 Length:471 Species:Homo sapiens


Alignment Length:298 Identity:67/298 - (22%)
Similarity:113/298 - (37%) Gaps:31/298 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVAVVGAGGGIGQPLSLLLRRCPGIDELALHDLSE-MKGIATDLSHISQTGKVIGFTGEKELESA 87
            |:.||| ||.:|...:|.:......|.|.|.|||| .||...||...:.....|    .|:|.::
Human   184 KITVVG-GGELGIACTLAISAKGIADRLVLLDLSEGTKGATMDLEIFNLPNVEI----SKDLSAS 243

  Fly    88 VSGADVVVVAAGMPRLPGMQRDHLMAANGNVAV--KVATAISNASPRAHLAFITNPVNMIVPAAA 150
            .....|:.....:    |..:.:|.....||.:  .:..|:.:.|..:.|...:.||.::    .
Human   244 AHSKVVIFTVNSL----GSSQSYLDVVQSNVDMFRALVPALGHYSQHSVLLVASQPVEIM----T 300

  Fly   151 EVLMAHGTFDSRRLFGI-TTLDVVRSKKFIGDSMNISPDDVNIPVIGGHAGITILPLISQCQPIY 214
            .|.....||.:.|:.|| ..||..|.:..|.:.:........:.|||......:|....|     
Human   301 YVTWKLSTFPANRVIGIGCNLDSQRLQYIITNVLKAQTSGKEVWVIGEQGEDKVLTWSGQ----- 360

  Fly   215 RCDLQEIQNLTHRIQ--EAGTEVVNAKAGKGSATLSMAYAGATFVNSLLRGIAGQDGLIECAFVA 277
                :|:.:.|.::|  ....|::..   ||..:.|:..:.|..|:|::........:...|...
Human   361 ----EEVVSHTSQVQLSNRAMELLRV---KGQRSWSVGLSVADMVDSIVNNKKKVHSVSALAKGY 418

  Fly   278 SKLTDAPFFASPLELGKDGIKRYIPLPQMSDYEKEALE 315
            ..:....|.:.|..||.:|:...|......|...|.|:
Human   419 YDINSEVFLSLPCILGTNGVSEVIKTTLKEDTVTEKLQ 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 60/286 (21%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 60/286 (21%)
UEVLDNP_001035787.1 UEV 21..138 CDD:283415
PLN02602 161..471 CDD:178212 67/298 (22%)
LDH_1 180..468 CDD:133429 67/298 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.