DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and Uevld

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001035785.1 Gene:Uevld / 54122 MGIID:1860490 Length:471 Species:Mus musculus


Alignment Length:305 Identity:71/305 - (23%)
Similarity:112/305 - (36%) Gaps:73/305 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVAVVGAGG-GIGQPLSLLLRRCPGI-DELALHDLSE-MKGIATDLSHISQTGKVIGFTGEKELE 85
            |:.|||:|. ||...|::..:   || |:|.|.|||: |.....||...:.....|    .|:|.
Mouse   184 KITVVGSGDLGIACTLAISAK---GIADKLLLLDLSDGMSQGTMDLDIFNLPNVEI----SKDLS 241

  Fly    86 SAVSGADVVVVAAGMPRLPGMQRDHLMAANGNVAV--KVATAISNASPRAHLAFITNPVNMIVPA 148
            ::.....|:..|..:    |....:|.|...||.:  .:..|:.:.|..|.|...:.||.::   
Mouse   242 ASAHSKVVIFTANSL----GGSESYLHAVQSNVDMFRALVPALGHYSQHAVLLVASQPVEIM--- 299

  Fly   149 AAEVLMAHGTFDSRRLFGI-TTLDVVRSKKFIGDSMNISPDDVNIPVIG-----------GHAGI 201
             :.|.....||.:.|:.|| ..||..|.:..|...:.:......:.|:|           |..| 
Mouse   300 -SYVTWKLSTFPATRVVGIGCNLDSQRLQYIITSVLKVQTSGKEVWVVGEQGENKVCSWSGRDG- 362

  Fly   202 TILPLISQCQPIYRCDLQEIQNLTHRIQEAGTEVVNAKAGKG-SATLSMAYAGATFVN------- 258
             :|...||.|                :.....|::..|..:. |..||:|....|.:|       
Mouse   363 -VLSPSSQAQ----------------LSSRAMELLKVKGQRSWSVGLSVADLVDTIINNKRKVHS 410

  Fly   259 --SLLRGIAGQDGLIECAFVASKLTDAPFFASPLELGKDGIKRYI 301
              :|.:|..|.|..:             |.:.|..||..|:...|
Mouse   411 VSTLAKGYYGLDNEV-------------FLSLPCILGTGGVSEVI 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 64/292 (22%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 64/292 (22%)
UevldNP_001035785.1 UEV 21..138 CDD:283415
PLN02602 177..471 CDD:178212 71/305 (23%)
NADB_Rossmann 183..468 CDD:304358 71/305 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.