DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and MDH1

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001303303.1 Gene:MDH1 / 4190 HGNCID:6970 Length:353 Species:Homo sapiens


Alignment Length:356 Identity:76/356 - (21%)
Similarity:130/356 - (36%) Gaps:77/356 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LKVAVVGAGGGIGQPL-------SLLLRRCPGIDELALHDLSEMKG------------------- 61
            ::|.|.||.|.|...|       |:..:..|.|  |.|.|::.|.|                   
Human     5 IRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPII--LVLLDITPMMGVLDGVLMELQDCALPLLKD 67

  Fly    62 -IATDLSHISQTGKVIGFTGEKELESAVSGADVVVVAAGMPRLPGMQRDHLMAANGNVAVKVATA 125
             ||||                || :.|....||.::...|||..||:|..|:.||..:......|
Human    68 VIATD----------------KE-DVAFKDLDVAILVGSMPRREGMERKDLLKANVKIFKSQGAA 115

  Fly   126 ISN-ASPRAHLAFITNPVNMIVPAAAEVLMAHGTFDSRRLFGITTLDVVRSKKFIGDSMNISPDD 189
            :.. |.....:..:.||.|.....|::   :..:........:|.||..|:|..|...:.::.:|
Human   116 LDKYAKKSVKVIVVGNPANTNCLTASK---SAPSIPKENFSCLTRLDHNRAKAQIALKLGVTAND 177

  Fly   190 VNIPVIGGHAGITILPLISQCQ--------PIYRC---DLQEIQNLTHRIQEAGTEVVNAKAGKG 243
            |...:|.|:...|..|.::..:        .:|..   |..........:|:.|..|:  ||.|.
Human   178 VKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEALKDDSWLKGEFVTTVQQRGAAVI--KARKL 240

  Fly   244 SATLSMAYAGATFVNSLLRGIAGQDGLIECAFVA-SKLTDAPFFASPLEL-------GKDGIKRY 300
            |:.:|.|.|....|..:..|..      |..||: ..::|...:..|.:|       .|:...::
Human   241 SSAMSAAKAICDHVRDIWFGTP------EGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKF 299

  Fly   301 IPLPQMSDYEKEALEKLLPILRQNADEGVNF 331
            :....::|:.:|.::.....|.:..:....|
Human   300 VEGLPINDFSREKMDLTAKELTEEKESAFEF 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 70/343 (20%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 70/343 (20%)
MDH1NP_001303303.1 MalateDH-SF1 2..327 CDD:130820 75/351 (21%)
MDH_cytoplasmic_cytosolic 3..328 CDD:133421 75/352 (21%)
PTS1 351..353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.