DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and CG10749

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_648616.1 Gene:CG10749 / 39470 FlyBaseID:FBgn0036328 Length:347 Species:Drosophila melanogaster


Alignment Length:324 Identity:169/324 - (52%)
Similarity:226/324 - (69%) Gaps:3/324 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 GVVVRTLKVAVVGAGGGIGQPLSLLLRRCPGIDELALHDLSEMKGIATDLSHISQTGKVIGFTGE 81
            |.:.|.|||||||:.|||||||||||:..|.|..|:|:|:....|:..|||||:....|..|.|:
  Fly    22 GYINRGLKVAVVGSVGGIGQPLSLLLKHNPQISTLSLYDIKNTTGVGVDLSHINTRASVCPFEGK 86

  Fly    82 KELESAVSGADVVVVAAGMPRLPGMQRDHLMAANGNVAVKVATAISNASPRAHLAFITNPVNMIV 146
            ..|:.|:..||:||:.||:||.|||:|:.|:..|.:||.:||.|.|...|.|.|||||||:|:||
  Fly    87 NGLKKAMDKADIVVIPAGLPRKPGMKREDLVDVNASVACEVAFAASEVCPGAMLAFITNPINVIV 151

  Fly   147 PAAAEVLMAHGTFDSRRLFGITTLDVVRSKKFIGDSMNISPDDVNIPVIGGHAGITILPLISQCQ 211
            |..|.:|.|.||:|..||||:|||||||::.|:.|.:|:.|..|||||||||.|.||||::|||.
  Fly   152 PIVATILKAKGTYDPNRLFGVTTLDVVRAQTFVADILNVDPQKVNIPVIGGHTGRTILPILSQCD 216

  Fly   212 PIYRCDLQEIQNLTHRIQEAGTEVVNAKAGKGSATLSMAYAGATFVNSLLRGIAG--QDGLIECA 274
            |.::...:|.:.|..|||.|||||||||.|.||||||||:|...||:||::||.|  .:.::|||
  Fly   217 PPFKGTDKEREALIQRIQNAGTEVVNAKDGLGSATLSMAFAATQFVSSLIKGIKGSKDECIVECA 281

  Fly   275 FVASKLTDAPFFASPLELGKDGIKRYIPLPQMSDYEKEALEKLLPILRQNADEGVNFAK-MILS 337
            :|.|.:|:|.|||:||.||..|:|....||.:.|.|::||..:||||:::..:|:...: ||.|
  Fly   282 YVESDVTEAQFFATPLILGPQGVKENTGLPDLDDEERKALNGMLPILKESIAKGIKLGEGMICS 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 153/298 (51%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 153/297 (52%)
CG10749NP_648616.1 MDH_glyoxysomal_mitochondrial 28..337 CDD:133422 164/308 (53%)
MDH_euk_gproteo 29..345 CDD:130833 165/315 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454810
Domainoid 1 1.000 159 1.000 Domainoid score I177
eggNOG 1 0.900 - - E1_COG0039
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 311 1.000 Inparanoid score I575
Isobase 1 0.950 - 0 Normalized mean entropy S410
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D366623at33208
OrthoFinder 1 1.000 - - FOG0001716
OrthoInspector 1 1.000 - - otm46892
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11540
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1106
1110.850

Return to query results.
Submit another query.