DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and Mdh1

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001303806.1 Gene:Mdh1 / 24551 RGDID:3072 Length:355 Species:Rattus norvegicus


Alignment Length:370 Identity:82/370 - (22%)
Similarity:139/370 - (37%) Gaps:82/370 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LKVAVVGAGGGIGQPL-------SLLLRRCPGIDELALHDLSEMKG------------------- 61
            ::|.|.||.|.|...|       |:..:..|.|  |.|.|::.|.|                   
  Rat     5 IRVLVTGAAGQIAYSLLYSIGNGSVFGKDQPII--LVLLDITPMMGVLDGVLMELQDCALPLLQD 67

  Fly    62 -IATDLSHISQTGKVIGFTGEKELESAVSGADVVVVAAGMPRLPGMQRDHLMAANGNVAVKVATA 125
             ||||                || |.|....||.|:...|||..||:|..|:.||..:......|
  Rat    68 VIATD----------------KE-EVAFKDLDVAVLVGSMPRREGMERKDLLKANVKIFKSQGAA 115

  Fly   126 ISN-ASPRAHLAFITNPVNMIVPAAAEVLMAHGTFDSRRLFGITTLDVVRSKKFIGDSMNISPDD 189
            :.. |.....:..:.||.|.....|::   :..:........:|.||..|:|..|...:.::.||
  Rat   116 LEKYAKKSVKVIVVGNPANTNCLTASK---SAPSIPKENFSCLTRLDHNRAKSQIALKLGVTADD 177

  Fly   190 VNIPVIGGHAGITILPLISQCQ--------PIYRCDLQEIQNLTHR----IQEAGTEVVNAKAGK 242
            |...:|.|:...|..|.::..:        .:|.. |::...|...    :|:.|..|:.|:   
  Rat   178 VKNVIIWGNHSSTQYPDVNHAKVKLQGKEVGVYEA-LKDDSWLKGEFITTVQQRGAAVIKAR--- 238

  Fly   243 GSATLSMAYAGATFVNSLLRGIAGQDGLIECAFVA-SKLTDAPFFASPLEL-------GKDGIKR 299
               .||.|.:.|..::..:|.|  ..|..|..||: ..::|...:..|.:|       .|:...:
  Rat   239 ---KLSSAMSAAKAISDHIRDI--WFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWK 298

  Fly   300 YIPLPQMSDYEKEALEKLLPILRQNADEGVNFAKMILSGQSHSPI 344
            ::....::|:.:|.::.....|.:..:....|   :.|...||.:
  Rat   299 FVEGLPINDFSREKMDLTAKELTEEKETAFEF---LSSAXLHSRV 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 73/344 (21%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 72/343 (21%)
Mdh1NP_001303806.1 MalateDH-SF1 2..327 CDD:130820 78/352 (22%)
MDH_cytoplasmic_cytosolic 3..328 CDD:133421 78/353 (22%)
PTS1 353..355
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.