DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and Ldhb

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001303262.1 Gene:Ldhb / 24534 RGDID:2997 Length:341 Species:Rattus norvegicus


Alignment Length:287 Identity:68/287 - (23%)
Similarity:126/287 - (43%) Gaps:53/287 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 KSLAKPATWGVVVRTLKVAVVGAGG-GIGQPLSLLLRRCPGIDELALHDLSE--MKGIATDLSHI 69
            |.:|..|.....|...|:.|||.|. |:...:|:|.:..  .|||||.|:.|  :||...||.|.
  Rat     7 KLIAPVADDETAVPNNKITVVGVGQVGMACAISILGKSL--ADELALVDVLEDKLKGEMMDLQHG 69

  Fly    70 S---QTGKVIGFTGEKELESAVSGADVVVVAAGMPRLPGMQRDHLMAANGNVAVKVATAISNASP 131
            |   ||.|::   .:|:. |..:.:.:|||.||:.:..|..|.:|:..|.||...:...|...||
  Rat    70 SLFLQTPKIV---ADKDY-SVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSP 130

  Fly   132 RAHLAFITNPVNMIVPAAAEVLMAHGTFDSRRLFGI---------TTLDVVRSKKFIGDSMNISP 187
            ...:..::|||:::            |:.:.:|.|:         ..||..|.:..:.:.:.|.|
  Rat   131 DCTIIVVSNPVDIL------------TYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHP 183

  Fly   188 DDVNIPVIGGH--------AGITILPL-ISQCQPIYRCD-----LQEIQNLTHRIQEAGTEVVNA 238
            ...:..::|.|        :|:.:..: :.:..|....|     .:|:..:   :.::..||:..
  Rat   184 SSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKM---VVDSAYEVIKL 245

  Fly   239 KAGKGSATLSMAYAGATFVNSLLRGIA 265
               ||....::..:.|..:.|:|:.::
  Rat   246 ---KGYTNWAIGLSVADLIESMLKNLS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 58/258 (22%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 58/258 (22%)
LdhbNP_001303262.1 PLN02602 4..332 CDD:178212 68/287 (24%)
LDH_1 20..330 CDD:133429 64/274 (23%)
PTS1 339..341
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.