DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and mdh-1

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_504656.1 Gene:mdh-1 / 179041 WormBaseID:WBGene00018491 Length:336 Species:Caenorhabditis elegans


Alignment Length:257 Identity:66/257 - (25%)
Similarity:106/257 - (41%) Gaps:55/257 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LKVAVVGAGGGIGQPLSLLLRRCPGI-------DELALHDLSE----MKGIATDLSH--ISQTGK 74
            |:|.|.||.|.||  .|:::|...|.       .||.|.|:.:    ::|:..:|..  :.....
 Worm     5 LRVLVTGAAGQIG--YSIVIRIADGTVFGKEQPVELVLLDVPQCSNILEGVVFELQDCALPTLFS 67

  Fly    75 VIGFTGEKELESAVSGADVVVVAAGMPRLPGMQRDHLMAANGNVAVKVATAISN-ASPRAHLAFI 138
            |:..|.||   ||.:|.|...:...|||..||:|..|:|||..:......|::. |.|...:..:
 Worm    68 VVAVTDEK---SAFTGIDYAFLVGAMPRREGMERKDLLAANVKIFKSQGKALAEYAKPTTKVIVV 129

  Fly   139 TNPVNMIVPAAAEVLMAHGTFDSRRLFGITTLDVVRSKKFIGDSMNISPDDV-NIPVIGGHAGIT 202
            .||.|.....||:  .|.|...::....:|.||..|:...:......:..:| |:.:.|.|:|  
 Worm   130 GNPANTNAFIAAK--YAAGKIPAKNFSAMTRLDHNRALAQLALKTGTTIGNVKNVIIWGNHSG-- 190

  Fly   203 ILPLISQCQPIYRCDLQEIQNLTH-RIQEAGTEVVNAKAGKGSATLSMAYAGATFVNSLLRG 263
                            .:..::|| .:.:.|||             :.||| |...|:.|:|
 Worm   191 ----------------TQFPDVTHATVNKNGTE-------------TDAYA-AVGDNAFLQG 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 58/244 (24%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 58/244 (24%)
mdh-1NP_504656.1 PRK05442 1..325 CDD:235468 66/257 (26%)
MDH_cytoplasmic_cytosolic 3..328 CDD:133421 66/257 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S410
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.