DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and MDH1B

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_001034934.1 Gene:MDH1B / 130752 HGNCID:17836 Length:518 Species:Homo sapiens


Alignment Length:248 Identity:49/248 - (19%)
Similarity:85/248 - (34%) Gaps:52/248 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 EKELESAVSGADVVVVAAGMPR----LPGMQRDHLMAANGNVAVKVATAISNASPRAHLAF---- 137
            |:.|::.::...|.:.:|..|.    :|.:....:...:..:::   |...|.....||..    
Human   122 EEALKTCINPLQVWITSASAPACYNLIPILTSGEVFGMHTEISI---TLFDNKQAEEHLKSLVVE 183

  Fly   138 ---ITNPVNMIVPAAAEVLMAHGTFDSRRLFGITTLDVVRSKKFIGDSMNISPDDVNIPVIGGHA 199
               :.:||...|....:|..|.     |:...|..||                |..|..|     
Human   184 TQDLASPVLRSVSICTKVEEAF-----RQAHVIVVLD----------------DSTNKEV----- 222

  Fly   200 GITILPLISQCQPIYRCDLQEIQNLTH---RIQEAGTEVVNAKAGKGSATLSMAYAGATFVNSLL 261
             .|:...:....|:.|.....|:...|   |:...|...||.|     ..|.|.|| ....::::
Human   223 -FTLEDCLRSRVPLCRLYGYLIEKNAHESVRVIVGGRTFVNLK-----TVLLMRYA-PRIAHNII 280

  Fly   262 RGIAGQDGLIECAFVASKLTDAPFFASPLEL-GKDGIKRYIPLPQMSDYEKEA 313
            ....|.:|..: |.:|.||..||.:...:.: |......|:.|.:...|..|:
Human   281 AVALGVEGEAK-AILARKLKTAPSYIKDVIIWGNISGNNYVDLRKTRVYRYES 332

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 49/248 (20%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 49/248 (20%)
MDH1BNP_001034934.1 MDH_like 9..459 CDD:133431 49/248 (20%)
MalateDH-SF1 131..457 CDD:130820 47/239 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.