DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10748 and Ldhal6b

DIOPT Version :9

Sequence 1:NP_648615.1 Gene:CG10748 / 39469 FlyBaseID:FBgn0036327 Length:349 Species:Drosophila melanogaster
Sequence 2:NP_780558.1 Gene:Ldhal6b / 106557 MGIID:2146830 Length:382 Species:Mus musculus


Alignment Length:320 Identity:76/320 - (23%)
Similarity:131/320 - (40%) Gaps:50/320 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 KVAVVGAGG-GIGQPLSLLLRRCPGI-DELALHDLSE--MKGIATDLSHISQTGKVIGFTGEKEL 84
            ||::||.|. |:...:.::.:   |: |||||.|.:|  |||...||.|.|...|:......|:.
Mouse    72 KVSIVGTGSVGMACAIGIIAK---GLTDELALVDNNEEKMKGETMDLQHGSVFMKMPNIVCSKDF 133

  Fly    85 ESAVSGADVVVVAAGMPRLPGMQRDHLMAANGNVAVKVATAISNASPRAHLAFITNPVNMIVPAA 149
            . ..:.::||::.||..:.....|.:|:..|..:...:...|...|||..:..::|||:::    
Mouse   134 R-VTANSEVVIITAGARQEKNETRLNLVQRNVTIFKAMVAEIIKHSPRCKIIVVSNPVDIL---- 193

  Fly   150 AEVLMAHGTFDSRRLFGI-TTLDVVRSKKFIGDSMNISPDDVNIPVIGGHAGITILPLISQCQPI 213
            ..|......|...|:.|. ..||..|.:..:|..:.|..:..:..|:|.| |.:.:|:.|... |
Mouse   194 TFVTWKLSGFPKNRIIGSGCNLDTARFRYMLGQRLGIHSESCHGWVLGEH-GDSSVPVWSGVN-I 256

  Fly   214 YRCDLQEIQNL------------THRIQEAGTEVVNAKAGKGSATLSMAYAGATFVNSLLRG--- 263
            ....|:|:.:.            .|:  |......|....||..:.::..:......|:|:.   
Mouse   257 AGVPLRELNSAIGTSKDPEKWGDVHK--EVIASAYNIIKMKGYTSWAIGLSVTDIAESILKNLRK 319

  Fly   264 -------IAGQDGLIECAFVASKLTDAPFFASPLELGKDGIKRYIPLPQMSDYEKEALEK 316
                   |.|..|:.|          ..|.:.|..||:.||...|.: ::|..|:..:.|
Mouse   320 THPVTTKIQGLYGIKE----------EVFLSVPCILGESGISDIIKV-KLSPTEEAQMVK 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10748NP_648615.1 MDH_euk_gproteo 36..333 CDD:130833 70/307 (23%)
MDH_glyoxysomal_mitochondrial 36..332 CDD:133422 70/307 (23%)
Ldhal6bNP_780558.1 LDH_1 70..379 CDD:133429 76/320 (24%)
L-LDH-NAD 75..375 CDD:273796 74/317 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0039
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.