DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10752 and CG12857

DIOPT Version :9

Sequence 1:NP_648614.1 Gene:CG10752 / 39467 FlyBaseID:FBgn0036325 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_610987.1 Gene:CG12857 / 36642 FlyBaseID:FBgn0033963 Length:440 Species:Drosophila melanogaster


Alignment Length:354 Identity:82/354 - (23%)
Similarity:151/354 - (42%) Gaps:32/354 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HQFEFMSNRLKEHMKYNILRNAVFYKKIPLQKKLKLALERNIGPHAYIIVNDTIYKCQVFVLRIY 86
            |.||.....||.....          |..|...|:...|.::.....|.:|:..:.|...||::|
  Fly    81 HNFEDADGWLKLEQPC----------KDRLATVLRYMFESHLKTTVQIEINNMYFNCHFIVLQVY 135

  Fly    87 CKLFTNNLKRGDIVKFPRDAMSNECFELAYTWMTNNAIHLPRDKIINLLAAAKCLQCIPLIKRIF 151
            .:.|:.......:|..|...:|.:.|.|:|.||.::...|....|:.:..||..|:...|....:
  Fly   136 SRFFSELEMIPLLVTLPEKIVSQKAFMLSYKWMLSDEPVLELAHIVEVYVAATYLRISGLAAHCW 200

  Fly   152 EFLNDYRTHCELFSFSCYLKAKD-MGMTQVADMMVSRVTKSFLVLVSNGQFIKMDIDGACTLLRS 215
            ::.:|...:.|..:...|:::|| ..|..|.::|::|:.|..|..|:...|:.:.......||.|
  Fly   201 KYFDDEEYYNEDTACVLYVESKDNPAMDVVRNLMLTRIRKFLLTFVATRDFLDLPTSHLIFLLES 265

  Fly   216 RHLAVQNEIEIFYSALLWLISNYEMRIKYIPRVLSLVRFLMIPAVFILQWTSNLKD--------L 272
            ..:.|..|||:|:.|:.||..::..|..::.|::|.:||.::|..::| :....:|        .
  Fly   266 DQICVNTEIEVFFIAVRWLGHDWNKRKVHVRRLMSCIRFNLMPLWYLL-YARREEDHPLVMKLIF 329

  Fly   273 RPE--------LANVLCHFLHNAMLSQFEYYTETFQSESIIRGNRRWAQDPQCPYLSLFNANGDS 329
            .||        ::.:......:| |...:..:|.:.|:|   |.|.|..|..|.|..........
  Fly   330 NPEVEYKIDESISRITSRMYEDA-LEGNDAQSEEYASDS---GQRNWICDSLCSYYHGVGCPNTR 390

  Fly   330 DLSPDVFFRYLRQIQNSPKSFVARLIMKD 358
            ::....|..||.::|...|...:::|.:|
  Fly   391 EIRFKHFEDYLSELQQCSKDHWSQVIFQD 419

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10752NP_648614.1 BACK 172..264 CDD:197943 27/92 (29%)
CG12857NP_610987.1 BTB 104..199 CDD:295341 23/94 (24%)
BACK 215..313 CDD:197943 28/97 (29%)
DUF4734 327..415 CDD:292506 18/91 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469501
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.