DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10752 and CG12692

DIOPT Version :9

Sequence 1:NP_648614.1 Gene:CG10752 / 39467 FlyBaseID:FBgn0036325 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001284857.1 Gene:CG12692 / 31372 FlyBaseID:FBgn0029703 Length:553 Species:Drosophila melanogaster


Alignment Length:470 Identity:95/470 - (20%)
Similarity:174/470 - (37%) Gaps:111/470 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 RNIGPHAYIIVNDTIYKCQVFVLRIYCKLFTNNLKRGDIVKFPRDAMSNECFELAYTWMTNNAIH 125
            |::|....:.:..:.:.|...:|:.:...|..|:...:..:...|.:: ..|..|||||   .:.
  Fly    57 RSLGAVTRVCIGTSTFWCTSSLLQFHSNYFDRNICPVNCFREGTDLIA-VGFRAAYTWM---RLQ 117

  Fly   126 LP------RDKIINLLAAAKCLQCIPLIKRIFEFLNDYRTHC-----ELFSFSCYLKA-KDMGMT 178
            .|      .||::.||..|..|: :|.:|.:.     |...|     |..:|..||:| |...:.
  Fly   118 EPLDPFMQPDKLMTLLHTAVQLE-MPALKALC-----YEQLCTDRFREETAFQVYLRALKYPQLE 176

  Fly   179 QVADMMVSRVTKSFLVLVSNGQFIKMDIDGACTLLRSRHLAVQNEIEIFYSALLWLISNYEMRIK 243
            ::..:|:.|:..:||.::....|.:|.::...|:|:...|.|.:|:|:..:.:.||....:...:
  Fly   177 ELRKLMLQRIGAAFLAVLGGDDFQRMPLEDVITMLQQDSLGVNSEMEVLVAIIRWLNCQSKCIDQ 241

  Fly   244 YIPRVLSLVRFLMIPAVFILQ-WTSNLKDLRPE--------------------LANVLCHFLHNA 287
            ..|.::..:|..::|...:.: |...:....|:                    :..|..|.||. 
  Fly   242 ATPLLMDCLRLTLLPLPILKRFWRCAMAPPVPDEPFMNAVRGNIHIRERISCAITVVQMHHLHT- 305

  Fly   288 MLSQFEYYTETFQSESIIRGNRRWAQDPQC---------PYLSLFNANGDSDLSPDVFFRYLRQI 343
              |:.|:.........::...|.|..|.||         ||..|...:..|:.:.....|.:...
  Fly   306 --SRREFLDFCRSKGLLVDMPREWIYDEQCHYHLPRPGGPYSHLICVHVISNYAIQRAQRLMESS 368

  Fly   344 QNSPKSFVARLIMKDHMEYEIGDALTVNE---------SWTSENSA----EDLKEPGEYNCAV-- 393
            :..|:.....:...|       |..|:||         ..:.|.||    |.|.:|.|.:|.:  
  Fly   369 KRWPRRVNTYMPPSD-------DLQTINELPEDKDEEAQVSVEPSAPEMSEGLPQPEEDDCFIAR 426

  Fly   394 ---GGTSSTEDLDAA-----------------------PN-----VKQTFYTSAVELDL--DLLA 425
               |......::.||                       ||     |..|..|.|.:.||  ||..
  Fly   427 LFRGTLLRLNEVMAAQDRNIERRIDNLIRDGTLRPRFIPNAMSRFVLPTAMTCAAQEDLQEDLFL 491

  Fly   426 KNHSVFDSDLDSSES 440
            :. ..:.|:||:.::
  Fly   492 QT-DFYSSNLDAIDA 505

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10752NP_648614.1 BACK 172..264 CDD:197943 19/92 (21%)
CG12692NP_001284857.1 BACK 162..265 CDD:285009 22/102 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469524
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.