DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10752 and CG10801

DIOPT Version :9

Sequence 1:NP_648614.1 Gene:CG10752 / 39467 FlyBaseID:FBgn0036325 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_570058.1 Gene:CG10801 / 31314 FlyBaseID:FBgn0029660 Length:558 Species:Drosophila melanogaster


Alignment Length:458 Identity:96/458 - (20%)
Similarity:159/458 - (34%) Gaps:138/458 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 MSNRLKEHMKYNIL--------RNAVFYK--KIPLQKKLKLALERNIGPHAYIIVNDTIYKCQVF 81
            ||::|.|....|||        .|.:.:|  |:.....|::.:|...                .|
  Fly   169 MSSKLDESCAENILSRCTRRMNNNEIMWKATKMCWFDDLEIQIESRF----------------FF 217

  Fly    82 VLRIYCKLFTNNLKR--GDIVKFPRDAMSNECFELAYTWMTN-NAIHLPRDKIINLLAAAKCLQC 143
            |..|....|..|.::  ...::.|...:........|.||.| ....:....:|:..|||..|..
  Fly   218 VSHILFTYFARNFRKISSQFLQMPVQKIDMAVLIRIYEWMLNEEKTFVVGQNLISFYAAAHWLGV 282

  Fly   144 IPLIKRIFEFLNDYRTH--CELFSFSCYLKAKDMGMTQVADMMVSRVTKSFLVLVSNGQFIKMDI 206
            ..|||:.:...:....:  .|:.:|..|:.|||....::..:|.||:.|.||.:|::.:|::.|:
  Fly   283 HQLIKQAWSTFSADGVYDIWEINAFQAYIMAKDYRCPEIMIVMQSRLRKCFLPIVASWEFLEFDV 347

  Fly   207 DGACTLLRSRHLAVQNEIEIFYSALLWLISNYEMRIKYIPRVLSLVRFLM--------------- 256
            :...|||....|.|.:|.|||::...||..::..|.|:..:|:..|||.:               
  Fly   348 NEVTTLLEQDMLCVNSEDEIFFAVFHWLNYSWTERKKHAVKVMQKVRFGLLSPWLRRSICNMPEN 412

  Fly   257 --------IPAVFILQWTSNLKDLRPELANVLCHF-------------LHNAMLSQFEYYTETFQ 300
                    :|.:..|.|...|          ||..             |...||..||:...|  
  Fly   413 DRIGEIGQLPEICSLIWEGTL----------LCQAIIAIGQPEYRRSRLVRRMLRDFEHKRIT-- 465

  Fly   301 SESIIRGNRRWA--------QDPQCPYLSLFNANGDSDLSPDVFFRYLRQIQNSPKSFVARLIMK 357
                   .|.|.        .|.:|...        .:|:.:.|.|:|.::..:...|:..|   
  Fly   466 -------ERSWVFCEGVPHHHDKKCARY--------RELTFESFKRFLHRLHTNSDIFMESL--- 512

  Fly   358 DHMEYEIGDALTVNESWTSENSAEDLKEPGEYNCAVGGTSSTEDLDAAPNVKQT-----FYTSAV 417
                                 .|...|....|.|.:       |.:..|:.|:|     ||.:.:
  Fly   513 ---------------------KAVPNKITNTYRCCI-------DANFCPSYKRTCPMAPFYRTHL 549

  Fly   418 ELD 420
            :||
  Fly   550 DLD 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10752NP_648614.1 BACK 172..264 CDD:197943 30/114 (26%)
CG10801NP_570058.1 BACK 306..401 CDD:285009 31/94 (33%)
DUF4734 418..512 CDD:292506 21/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469516
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006713
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22667
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.