DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment atp1b2 and CG33310

DIOPT Version :9

Sequence 1:NP_989070.1 Gene:atp1b2 / 394667 XenbaseID:XB-GENE-1007085 Length:306 Species:Xenopus tropicalis
Sequence 2:NP_995718.2 Gene:CG33310 / 2768910 FlyBaseID:FBgn0053310 Length:876 Species:Drosophila melanogaster


Alignment Length:337 Identity:67/337 - (19%)
Similarity:117/337 - (34%) Gaps:118/337 - (35%)


- Green bases have known domain annotations that are detailed below.


 Frog    16 EFKEFMWNPRTREFMGRTASSWGLIVSFYLVFYAFLTGMFALS--------------MYVMLQTI 66
            |::...:|....::..|..|.| |....:.|.|.....:|:::              |..|.|..
  Fly   583 EWRRLFFNKIHGKYKLRRPSHW-LYTLVFSVLYILFVIIFSMAWFDFIKDDASRKVPMIKMAQPF 646

 Frog    67 DEYTPKYWDRLTSPGLMIRPKTDTLEIVYSISGNSSWAPYVSQLNSMLDPYNDTVQMQQGSVCPS 131
            ..:||            |.|:|:...:.:                   ||.|.|..|::    .:
  Fly   647 ISFTP------------IGPRTNPKAVSF-------------------DPRNSTEVMEK----YA 676

 Frog   132 GVFNKQDDTGDVRNYPKKACQFLRSSLGDCSGLTDPTYGYSTGSPCLLIKMNKIINF-------- 188
            |:....:..||..:.|:         .|.|:  .:..:||.:|.||:.:|:|:||.|        
  Fly   677 GIMALLEKYGDYGHNPR---------FGTCT--ANEKFGYPSGEPCVFLKVNRIIGFKTEPYINS 730

 Frog   189 ------------YPGVIPSLSNTSIT---INCTGTTANMDQ---ML-------GSRTYYPSSNPS 228
                        :..:...|.||:..   :|.|..|...|:   :|       ..||.|......
  Fly   731 DELVKAKIDEVEFTALKRLLENTTTEEGHLNRTWITCRSDKDKNVLIEFHPEPAIRTEYTDIEEK 795

 Frog   229 NGTSNGTSLGTMDLMYFPYYGNRAQKNYSQP-----LVAVKFYNLTLNQDLYVQCRANAVNINTN 288
                            ..|..|..:|::..|     :||:|..||..|:.:::.|:..|.||:  
  Fly   796 ----------------IEYIANEGKKSFFGPNDVNRIVALKIKNLKANERVHINCKMWAQNIH-- 842

 Frog   289 DSQDKFSGRVSF 300
             .:.:..|:|||
  Fly   843 -HRKEGYGQVSF 853

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
atp1b2NP_989070.1 Na_K-ATPase 15..299 CDD:366001 64/334 (19%)
CG33310NP_995718.2 Na_K-ATPase <703..847 CDD:298651 35/162 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D422722at33208
OrthoFinder 1 1.000 - - FOG0000357
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.