DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14118 and NUC1

DIOPT Version :9

Sequence 1:NP_648612.1 Gene:CG14118 / 39465 FlyBaseID:FBgn0036323 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_012327.1 Gene:NUC1 / 853222 SGDID:S000003744 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:200 Identity:49/200 - (24%)
Similarity:81/200 - (40%) Gaps:38/200 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   259 RGHLTAKADLIYASQ-QKSSFNYMNVAPQ-WQSFNGGQWSKLE----ESTRQYVARSGITATVY- 316
            |||....||..::.| ...:|...|:.|| .:.||...|:.||    ..|::|.:...:|..:| 
Yeast   136 RGHQAPAADAKFSQQAMDDTFYLSNMCPQVGEGFNRDYWAHLEYFCRGLTKKYKSVRIVTGPLYL 200

  Fly   317 ---TGIYGEMKVAGSKVLHMTTNANNIG---VVAVPQLFYRVLIDE---GHPTRG----IALVGV 368
               ..|..:.:|          |...||   .:|||..|:::::.|   .:|.|.    .|.|..
Yeast   201 PKKDPIDNKFRV----------NYEVIGNPPSIAVPTHFFKLIVAEAPTANPAREDIAVAAFVLP 255

  Fly   369 NNPHATLAQIHESYIICDPVEES--VQWLSWLHKSNAKGNLK--NGYLYACSVANLA----RAVG 425
            |.|.:...::.:..:..|.:|.|  ::.|..:..|..|...|  |..:.....:|.|    :.|.
Yeast   256 NEPISNETKLTDFEVPIDALERSTGLELLQKVPPSKKKALCKEVNCQIVVRDFSNAAIKQSKDVK 320

  Fly   426 HLPRP 430
            .||.|
Yeast   321 LLPPP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14118NP_648612.1 NUC 175..428 CDD:238043 46/196 (23%)
NUC1NP_012327.1 NUC1 8..308 CDD:224777 43/181 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.