DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14118 and zgc:158445

DIOPT Version :9

Sequence 1:NP_648612.1 Gene:CG14118 / 39465 FlyBaseID:FBgn0036323 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001073540.2 Gene:zgc:158445 / 798069 ZFINID:ZDB-GENE-061215-78 Length:261 Species:Danio rerio


Alignment Length:90 Identity:30/90 - (33%)
Similarity:43/90 - (47%) Gaps:16/90 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   257 LARGHLTAKADLIYASQQK---SSFNYMNVAPQWQSFNGGQWSKLEESTRQYVARSGIT------ 312
            ::||||..|:   ||..|:   ::|...||.||.:.||.|:|||.|...:..:....::      
Zfish   122 MSRGHLFPKS---YAVDQEAAYATFTLTNVVPQQKKFNNGEWSKKENEFKSSMDTDCLSNNGRPE 183

  Fly   313 ATVYTG-IYGEMKVAGSKV---LHM 333
            |.|.|| |..|..:...||   .||
Zfish   184 AFVVTGAIPSEKTLLNDKVNIPTHM 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14118NP_648612.1 NUC 175..428 CDD:238043 30/90 (33%)
zgc:158445NP_001073540.2 Endonuclease_NS 64..227 CDD:214889 30/90 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1112751at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.