DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14118 and Sid

DIOPT Version :9

Sequence 1:NP_648612.1 Gene:CG14118 / 39465 FlyBaseID:FBgn0036323 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_651627.1 Gene:Sid / 43390 FlyBaseID:FBgn0039593 Length:370 Species:Drosophila melanogaster


Alignment Length:335 Identity:70/335 - (20%)
Similarity:123/335 - (36%) Gaps:75/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 DLPRLDKVQPLYLRPGT-------DLYWLPNAYGHL-------EVQRGASIELHCSHSFAPANGE 110
            ||..:..:..||...|:       ||..|...|.:|       ::||...:|:|           
  Fly     3 DLKYMLTILSLYFFVGSVQANCLIDLAHLNANYVYLSQNNGVYDIQRSDIVEIH----------- 56

  Fly   111 SLDAKLRSIRVKCVQDTTFEWMGAKIHFSDFVCNHSMPYTVERLDRSCGSDTP----SPST---- 167
                           .|.:......:|.:.|:|.:...::......:|....|    .|.|    
  Fly    57 ---------------QTLYLLCNGGLHRTTFLCRYDSVFSPALSSAACAPPDPVVVKVPDTSCSI 106

  Fly   168 -SYLYRVGYDTGDGRFVATMELCHDPNQLRTHYAHHQLTPANVHFQKKLKRPR--FSTAGHFTGF 229
             |..:.||: :.:|||:.....|.|...|...::.::.    ..:...:.||.  :.:.....||
  Fly   107 PSATFAVGF-SFNGRFMELYRNCFDGYSLAFQHSIYKA----YRYVNTVPRPNPTWQSDQLSGGF 166

  Fly   230 DMARIYSPKSQEKLMVPGLIDVKSGLFLARGHLTAKADLIYASQQKSSFNYMNVAPQWQSFNGGQ 294
            |.|  |..::.:..::..|..|:......|||:|..:..|....:||:|.|:|..||::..|.|:
  Fly   167 DNA--YEGRATQACLLTNLGAVQPQCKFDRGHMTPASAFISTELKKSTFRYLNAIPQYRGVNRGK 229

  Fly   295 WSKLEESTRQYVARSGITATVYTGI-----YGEMKVA----GSKVLHMTTNANNIGV-------V 343
            |..:|......| |......:...:     |..:||.    |...|...||.|.|.:       :
  Fly   230 WKAVETWVNNMV-RGLYDNPIINNVQIPRTYDVLKVCIGALGVHRLRHNTNNNMIPIYLLDNNKI 293

  Fly   344 AVPQLFYRVL 353
            .||:..|:::
  Fly   294 PVPEWMYKIV 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14118NP_648612.1 NUC 175..428 CDD:238043 45/197 (23%)
SidNP_651627.1 Endonuclease_NS 106..358 CDD:279553 48/206 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450472
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.