DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14118 and Tengl4

DIOPT Version :9

Sequence 1:NP_648612.1 Gene:CG14118 / 39465 FlyBaseID:FBgn0036323 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_650038.2 Gene:Tengl4 / 41321 FlyBaseID:FBgn0037857 Length:378 Species:Drosophila melanogaster


Alignment Length:187 Identity:39/187 - (20%)
Similarity:71/187 - (37%) Gaps:55/187 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   212 QKKLKRPRFSTAGHFTGFDMARIYSPKSQEKLMVPGLIDVKSGLFLARGHLTA----KADLIYAS 272
            :|.|.:|.    .:.|...:..|:|...:         |.|:..::. |||.:    |.|   |.
  Fly   181 EKTLNKPN----AYITDNTIPTIFSANMR---------DFKNSDWVG-GHLASPQNYKCD---AL 228

  Fly   273 QQKSSFNYMNVAPQWQSFNGGQWSKLEESTRQYVARSGI---TATVYTG-IYGEMKVAGSK---- 329
            :...::.:.|:.|..:......|.:||    .||....|   :..|||| ::...::....    
  Fly   229 KFLEAYKFTNIVPINRGLKNHIWYRLE----SYVRDKAIEFDSVHVYTGPLFMPQRITFRNWSVR 289

  Fly   330 --VLHMTTNANNIGVVAVPQLFYRVLIDEGHPTRGIALVGVNNPHATLAQIHESYII 384
              |:.|.|       ||||..|::::|.|....|.:.::             |.|::
  Fly   290 YHVMGMNT-------VAVPTHFFKIIIREDEFNRDMPIM-------------EGYVV 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14118NP_648612.1 NUC 175..428 CDD:238043 39/187 (21%)
Tengl4NP_650038.2 Endonuclease_NS 132..362 CDD:279553 39/187 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.