DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14118 and EndoG

DIOPT Version :9

Sequence 1:NP_648612.1 Gene:CG14118 / 39465 FlyBaseID:FBgn0036323 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_610737.1 Gene:EndoG / 36309 FlyBaseID:FBgn0033690 Length:310 Species:Drosophila melanogaster


Alignment Length:379 Identity:79/379 - (20%)
Similarity:120/379 - (31%) Gaps:162/379 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 GLHIDGEMFHQGSPCRVDVQNDLPRLDKVQPLYLRPGTDLYWLPNAYGHLEVQRGASIELHCSHS 103
            |.|::.|..|.||      .:.||||         ||     || .:|.:.           :.|
  Fly    23 GTHVERERQHNGS------TSGLPRL---------PG-----LP-TFGTVS-----------AAS 55

  Fly   104 FAPANGESLDAKLRSIRVKCVQDTTFEWMGAKIHFSDFVCNHSMPYTVERLDRSCGSDTPSPSTS 168
            ..||...::.......|:..:....|..:       |.|.:||                     .
  Fly    56 LIPAQENNVSLTATPSRIGQIMKYGFPGL-------DHVRSHS---------------------D 92

  Fly   169 YLYRVGYDTGDGRFVATMELCHDPNQLRTHYAHHQLTPANVHFQKKLKR------------PRF- 220
            |:                 |.:|......|:....||..:|.....:.|            |.| 
  Fly    93 YV-----------------LSYDRRNRVPHWVFEHLTAESVAKNDAVDRSKCDFKQDESIHPFFR 140

  Fly   221 --STAGHFTGFDMARIYSPKSQEKLMVPGLIDVKSGLFLARGHLTAKADLIYASQQK---SSFNY 280
              :|....:|:|                            |||:.|..:  :...||   .:|..
  Fly   141 SQNTDYRRSGYD----------------------------RGHMAAAGN--HRLHQKHCDETFYL 175

  Fly   281 MNVAPQ-WQSFNGGQWSKLEESTRQYVARSGITATVYTGIY---GEMKV------AGSKVLHMTT 335
            .|:||| .|.||...|:.||...|:      :|.| |:.:|   |.:.:      ..|.|.:...
  Fly   176 SNMAPQVGQGFNRDAWNTLEAHVRR------LTKT-YSNVYVCTGPLYLPHKEDDGKSYVKYEVI 233

  Fly   336 NANNIGVVAVPQLFYRVLIDEGHPTRGIALVGVNNPHATLAQIH-ESYIICDPV 388
            .||   .||||..||:|            :||.:..|    ::| |||::.:.|
  Fly   234 GAN---TVAVPTHFYKV------------IVGESADH----KLHMESYVMPNQV 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14118NP_648612.1 NUC 175..428 CDD:238043 54/243 (22%)
EndoGNP_610737.1 NUC1 39..305 CDD:224777 73/357 (20%)
NUC 77..309 CDD:238043 60/293 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450458
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.