DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14118 and Endog

DIOPT Version :9

Sequence 1:NP_648612.1 Gene:CG14118 / 39465 FlyBaseID:FBgn0036323 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_001030110.1 Gene:Endog / 362100 RGDID:1310763 Length:294 Species:Rattus norvegicus


Alignment Length:243 Identity:61/243 - (25%)
Similarity:93/243 - (38%) Gaps:54/243 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   163 PSPSTSYLYRVGY-DTGDGRFVATMELCHDPNQLRTHYAHHQLTPANVHFQKKLKRPRFSTAGHF 226
            |:.||..|.:.|. .....|...:..|.:||......:...||.|      ::|:......|..|
  Rat    54 PAGSTGELAKYGLPGVAQLRSRESYVLSYDPRTRGALWVLEQLRP------ERLRGDGDRRACDF 112

  Fly   227 TGFDMARIYSPKSQEKLMVPGLIDVKSGLFLARGHLTAKADLIYASQ-QKSSFNYMNVAPQWQSF 290
            ...|....|...:.        .|.:...| .||||.|.|:..::.: ...:|...|||||....
  Rat   113 HEDDSVHAYHRATN--------ADYRGSGF-DRGHLAAAANHRWSQRAMDDTFYLSNVAPQVPHL 168

  Fly   291 NGGQWSKLEESTRQYVARSGITATVYTGIY---GEMKV------AGSKVLHMTTNANNIGVVAVP 346
            |...|:.||:.:|      .:|.| |..:|   |.:.:      ..|.|.:.....|:   ||||
  Rat   169 NQHAWNNLEKYSR------SLTRT-YQNVYVCTGPLFLPRTEADGKSYVKYQVIGKNH---VAVP 223

  Fly   347 QLFYRVLIDEGHPTRGIALVGVNNPHATLAQIH-ESYIICD-PVEESV 392
            ..|::|||.|                |...||. .||::.: ||:|::
  Rat   224 THFFKVLILE----------------AASGQIELRSYVMPNAPVDETL 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14118NP_648612.1 NUC 175..428 CDD:238043 56/231 (24%)
EndogNP_001030110.1 NUC 75..281 CDD:214683 55/222 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.