DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14118 and Tengl1

DIOPT Version :9

Sequence 1:NP_648612.1 Gene:CG14118 / 39465 FlyBaseID:FBgn0036323 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_722780.1 Gene:Tengl1 / 318883 FlyBaseID:FBgn0051682 Length:319 Species:Drosophila melanogaster


Alignment Length:187 Identity:45/187 - (24%)
Similarity:76/187 - (40%) Gaps:27/187 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   229 FDMARIYSPKSQEKLMVPGLIDVKSGLFLARGHLTAKADLIYASQQKSSFNYMNVAPQW-QSFNG 292
            ||....:..::...|.:...:|:.:.:........|.|.....|:....|...|:.|.. :.||.
  Fly    97 FDFVTSFDRRNSAILWMCERVDLSNRVVYGDSTSVAPAGAFGQSEAARVFFLSNIRPFLNRGFNL 161

  Fly   293 GQWSKLEESTRQYVARSGITATVYTG-IY--GEMKVAGSKVLHMTTNANNIGVVAVPQLFYRVL- 353
            ..|.:|.:...:...|.| |...||| ||  .|:| :.|..|...:....  :||||..|:::| 
  Fly   162 TVWDRLLQYVHEMSQRHG-TVYAYTGSIYLPRELK-SNSWFLEFQSEERT--MVAVPTHFFKILV 222

  Fly   354 IDEGHPTRGIALVGVNNPHATLAQIHESYIICD-PVEESVQWLSWLHK----SNAKG 405
            ||:       ...|...|:|      |:|::.: |:..:|:..:.|..    .||.|
  Fly   223 IDK-------KFAGDTIPYA------EAYVMPNSPLNNNVELKTLLSDVREIENATG 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14118NP_648612.1 NUC 175..428 CDD:238043 45/187 (24%)
Tengl1NP_722780.1 Endonuclease_NS 98..275 CDD:214889 44/186 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.