DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14118 and Exog

DIOPT Version :9

Sequence 1:NP_648612.1 Gene:CG14118 / 39465 FlyBaseID:FBgn0036323 Length:439 Species:Drosophila melanogaster
Sequence 2:NP_766044.1 Gene:Exog / 208194 MGIID:2143333 Length:368 Species:Mus musculus


Alignment Length:174 Identity:40/174 - (22%)
Similarity:76/174 - (43%) Gaps:28/174 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 ARGHLTAKADLIYASQQKSSFNYM-NVAPQWQSFNGGQWSKLEESTRQYVAR-------SGITAT 314
            :|||:....:..::|:..:...|: |:.||....|.|.|:::|...|:...|       ||....
Mouse   137 SRGHMAPAGNNKFSSEAMAETFYLSNIVPQNFDNNSGYWNRIEMYCRELTERFEDVWIVSGPLTL 201

  Fly   315 VYTGIYGEMKVAGSK-VLHMTTNANNIGVVAVPQLFYRVLIDEGHP--TRGIALVGVNNPHATL- 375
            .:|      :..|:| |.:.....:|   ||||...|:|::....|  |..:||.....|:..: 
Mouse   202 PHT------RNDGTKTVSYQVIGEDN---VAVPSHLYKVILARRSPESTEPLALGAFVVPNKAIG 257

  Fly   376 --AQIHESYIICDPVEESVQWLSWLHKSNAKGNLKNGYLYACSV 417
              :|:.|..:....:|: :..|.:..:.:...:::|    .|||
Mouse   258 FQSQLSEFQVSLHDLEK-MSGLVFFPRLDRSRDIRN----ICSV 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14118NP_648612.1 NUC 175..428 CDD:238043 40/174 (23%)
ExogNP_766044.1 NUC 77..287 CDD:214683 36/159 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838194
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.