DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14120 and EXOG

DIOPT Version :9

Sequence 1:NP_648610.1 Gene:CG14120 / 39463 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_005098.2 Gene:EXOG / 9941 HGNCID:3347 Length:368 Species:Homo sapiens


Alignment Length:374 Identity:90/374 - (24%)
Similarity:136/374 - (36%) Gaps:121/374 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   141 SGKDCNGGTD---LVQVGFEVEDGGFLQSYELCHDAEAEATRYVHHVLYPSSYDYQHGVARPNFL 202
            :||..:|..:   |.|.||.:              ...||..|.:|.|   |||....|.|    
Human    49 TGKQPDGSAEKAVLEQFGFPL--------------TGTEARCYTNHAL---SYDQAKRVPR---- 92

  Fly   203 ELDFYGGRDVNTKYTQVQQNITISNILGLDAS-------------PYFN-FSDDRI---LSRGHM 250
                           .|.::|:.|.|:| ||.             |.|: |::|.:   .|||||
Human    93 ---------------WVLEHISKSKIMG-DADRKHCKFKPDPNIPPTFSAFNEDYVGSGWSRGHM 141

  Fly   251 I-AKTDQIFGAAQHTTFLFINVAPQWQTFNGGNWEKVETSVRKFVADRNLTTDCYTGTWGVS--- 311
            . |..::....|...||...|:.||....|.|.|.::|...|:.       |:.:...|.||   
Human   142 APAGNNKFSSKAMAETFYLSNIVPQDFDNNSGYWNRIEMYCREL-------TERFEDVWVVSGPL 199

  Fly   312 TLPDVDGIEREL--YLDFDENNNGLIPVPKIYFRVVIDR---VTREGIVL---------IGINNP 362
            |||...|..:::  |....|:|   :.||...::|::.|   |:.|.:.|         ||. .|
Human   200 TLPQTRGDGKKIVSYQVIGEDN---VAVPSHLYKVILARRSSVSTEPLALGAFVVPNEAIGF-QP 260

  Fly   363 YLTLEQIQKDYILCQDIGHQLSWLTWYKE-DLHEGYSYACSVE-----DFIEVVKDLPLEDLH-T 420
            .||..|:.     .||: .:||.|.::.. |........|||:     ||.|....|....:. .
Human   261 QLTEFQVS-----LQDL-EKLSGLVFFPHLDRTSDIRNICSVDTCKLLDFQEFTLYLSTRKIEGA 319

  Fly   421 NGILGLDDV------TTVEP----------------STTESSTTTEEPS 447
            ..:|.|:.:      ..:||                :..:|.|...:||
Human   320 RSVLRLEKIMENLKNAEIEPDDYFMSRYEKKLEELKAKEQSGTQIRKPS 368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043 75/292 (26%)
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043
EXOGNP_005098.2 NUC 77..286 CDD:214683 65/248 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165148106
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.