DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14120 and NUC1

DIOPT Version :9

Sequence 1:NP_648610.1 Gene:CG14120 / 39463 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_012327.1 Gene:NUC1 / 853222 SGDID:S000003744 Length:329 Species:Saccharomyces cerevisiae


Alignment Length:288 Identity:62/288 - (21%)
Similarity:98/288 - (34%) Gaps:96/288 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 FEVEDGGF-----------LQSYE---LCHDAEAEATRYVHHVLYPSSYDYQHGVARPNFLELD- 205
            |.|:..||           ||:.|   .|::.:.:...:|...:.|.|...::...:.:|.:.| 
Yeast    52 FNVDPSGFFKYGFPGPIHDLQNREEFISCYNRQTQNPYWVLEHITPESLAARNADRKNSFFKEDE 116

  Fly   206 -----FYGG-RDVNTKYTQVQQNITISNILGLDASPYFNFSDDRILSRGHMIAKTDQIFG-AAQH 263
                 |.|. ||                        ||....|    |||.....|..|. .|..
Yeast   117 VIPEKFRGKLRD------------------------YFRSGYD----RGHQAPAADAKFSQQAMD 153

  Fly   264 TTFLFINVAPQ-WQTFNGGNWEKVETSVR----KFVADRNLTTDCYTGTWGVSTLPDVDGIEREL 323
            .||...|:.|| .:.||...|..:|...|    |:.:.|.:|...|        ||..|.|:.:.
Yeast   154 DTFYLSNMCPQVGEGFNRDYWAHLEYFCRGLTKKYKSVRIVTGPLY--------LPKKDPIDNKF 210

  Fly   324 YLDFDE-NNNGLIPVPKIYFRVVIDRV-----TREGIVLIGI--------NNPYLT--------- 365
            .::::. .|...|.||..:|::::...     .||.|.:...        |...||         
Yeast   211 RVNYEVIGNPPSIAVPTHFFKLIVAEAPTANPAREDIAVAAFVLPNEPISNETKLTDFEVPIDAL 275

  Fly   366 -----LEQIQ-----KDYILCQDIGHQL 383
                 ||.:|     |...||:::..|:
Yeast   276 ERSTGLELLQKVPPSKKKALCKEVNCQI 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043 58/269 (22%)
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043
NUC1NP_012327.1 NUC1 8..308 CDD:224777 62/288 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.