DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14120 and zgc:158445

DIOPT Version :10

Sequence 1:NP_648610.1 Gene:CG14120 / 39463 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_001073540.2 Gene:zgc:158445 / 798069 ZFINID:ZDB-GENE-061215-78 Length:261 Species:Danio rerio


Alignment Length:124 Identity:30/124 - (24%)
Similarity:48/124 - (38%) Gaps:37/124 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   245 LSRGHMIAKTDQIFGAAQHTTFLFINVAPQWQTFNGGNWEKVETSVRKFVADRNLTTDC------ 303
            :||||:..|:..:...|.:.||...||.||.:.||.|.|.|.|...:.     ::.|||      
Zfish   122 MSRGHLFPKSYAVDQEAAYATFTLTNVVPQQKKFNNGEWSKKENEFKS-----SMDTDCLSNNGR 181

  Fly   304 ---YTGTWGV----STLPDVDGIERELYLDF-------------------DENNNGLIP 336
               :..|..:    :.|.|...|...:|:.|                   :||:..::|
Zfish   182 PEAFVVTGAIPSEKTLLNDKVNIPTHMYMAFCCYNKNTKKWVTKAYCATNEENSRAVLP 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043 30/124 (24%)
NUC 718..967 CDD:469610
NUC 1111..1359 CDD:238043
zgc:158445NP_001073540.2 Endonuclease_NS 64..227 CDD:214889 27/109 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.