DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14120 and Endog

DIOPT Version :9

Sequence 1:NP_648610.1 Gene:CG14120 / 39463 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_001030110.1 Gene:Endog / 362100 RGDID:1310763 Length:294 Species:Rattus norvegicus


Alignment Length:245 Identity:54/245 - (22%)
Similarity:87/245 - (35%) Gaps:58/245 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly  1084 GRPCNGGTDLLEVGF----QLSSSSSDDFLQTYDVCHDELSEVTRYVHHVLYPGSDQYQRSVSRP 1144
            |.|.....:|.:.|.    ||.|..|      |.:.:|..:....:|...|            ||
  Rat    52 GGPAGSTGELAKYGLPGVAQLRSRES------YVLSYDPRTRGALWVLEQL------------RP 98

  Fly  1145 SFIPG-------DFYGGKDVNTLYTQVQQNITVSEILGMDASPYFNTTGNVYLARGHLSAKTDFV 1202
            ..:.|       ||:....|:..:.....:...|   |.|              ||||:|..:..
  Rat    99 ERLRGDGDRRACDFHEDDSVHAYHRATNADYRGS---GFD--------------RGHLAAAANHR 146

  Fly  1203 FGAAQKA---SFFFVNAAPQWQTFNGGNWERIEDSVRKFVAD-ENITVDCYTGTWGVSTLPDVNG 1263
            :  :|:|   :|:..|.|||....|...|..:|...|..... :|:.| |    .|...||....
  Rat   147 W--SQRAMDDTFYLSNVAPQVPHLNQHAWNNLEKYSRSLTRTYQNVYV-C----TGPLFLPRTEA 204

  Fly  1264 IGRELYLDFDENNNGLIPVPKLYFRVIIDRESRNGIVLLGVNNPHATIEQ 1313
            .|:. |:.:.......:.||..:|:|:|...:...|.|.....|:|.:::
  Rat   205 DGKS-YVKYQVIGKNHVAVPTHFFKVLILEAASGQIELRSYVMPNAPVDE 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043 46/214 (21%)
EndogNP_001030110.1 NUC 75..281 CDD:214683 47/222 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.