DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14120 and Exog

DIOPT Version :9

Sequence 1:NP_648610.1 Gene:CG14120 / 39463 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_766044.1 Gene:Exog / 208194 MGIID:2143333 Length:368 Species:Mus musculus


Alignment Length:330 Identity:77/330 - (23%)
Similarity:119/330 - (36%) Gaps:86/330 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 LVQVGFEVEDGGFLQSYELCHDAEAEATRYVHHVLYPSSYDYQHGVARPNFLELDFYGGRDVNTK 215
            |.|.||.:              |..|..||.:|.|   |||....|.|                 
Mouse    62 LEQFGFPL--------------AGTETRRYTNHAL---SYDQAKRVPR----------------- 92

  Fly   216 YTQVQQNITISNILGLDA--------------SPYFNFSDDRI---LSRGHMI-AKTDQIFGAAQ 262
              .|.::|:...|:| ||              |.:...::|.|   .|||||. |..::....|.
Mouse    93 --WVLEHISKDKIIG-DADRKHCKFKPDPSVPSAFSALNEDYIGSGWSRGHMAPAGNNKFSSEAM 154

  Fly   263 HTTFLFINVAPQWQTFNGGNWEKVETSVRKFVADRNLTTDCYTGTWGVS---TLPDV--DGIERE 322
            ..||...|:.||....|.|.|.::|...|:.       |:.:...|.||   |||..  ||.:..
Mouse   155 AETFYLSNIVPQNFDNNSGYWNRIEMYCREL-------TERFEDVWIVSGPLTLPHTRNDGTKTV 212

  Fly   323 LYLDFDENNNGLIPVPKIYFRVVIDRVTREGIVLIGI------NNPYLTLEQIQKDYILCQDIGH 381
            .|....|:|   :.||...::|::.|.:.|....:.:      |.......|:.:..:...|: .
Mouse   213 SYQVIGEDN---VAVPSHLYKVILARRSPESTEPLALGAFVVPNKAIGFQSQLSEFQVSLHDL-E 273

  Fly   382 QLSWLTWY-KEDLHEGYSYACSVEDFIEVVKDLPLED----LHTNGILGLDDVTTVEPSTTESST 441
            ::|.|.:: :.|........|||    :..|.|..::    |.|..|.|...|..:|.......:
Mouse   274 KMSGLVFFPRLDRSRDIRNICSV----DTCKLLGFQEFTLYLSTRKIDGARSVARLEKVLEALKS 334

  Fly   442 TTEEP 446
            :..||
Mouse   335 SGVEP 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043 65/281 (23%)
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043
ExogNP_766044.1 NUC 77..287 CDD:214683 57/243 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167838193
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.