DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG14120 and cps-6

DIOPT Version :9

Sequence 1:NP_648610.1 Gene:CG14120 / 39463 FlyBaseID:FBgn0036321 Length:1371 Species:Drosophila melanogaster
Sequence 2:NP_491371.1 Gene:cps-6 / 172045 WormBaseID:WBGene00000787 Length:308 Species:Caenorhabditis elegans


Alignment Length:313 Identity:65/313 - (20%)
Similarity:112/313 - (35%) Gaps:101/313 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   133 WPIFTALRSGKDCNGGTDLVQVGFEVEDGGFLQSYELCHDAEAEATRYVHHV---LYPSSYDYQH 194
            :|.||.:|:.:|                  |:.||:.       .||..|.|   |.|....:..
 Worm    74 YPGFTNVRTYED------------------FVLSYDY-------KTRTAHWVCEHLTPERLKHAE 113

  Fly   195 GVARPNFLELDFYGGRDVNTKYTQVQQNITISNILGLDASPYFNFSDDRILSRGHMIA----KTD 255
            ||.|                |..:.:.:||..... |..:..:..|.   ..|||:.|    :..
 Worm   114 GVDR----------------KLCEFKPDITFPQKF-LSQNTDYKCSG---FDRGHLAAAGNHRKS 158

  Fly   256 QIFGAAQHTTFLFINVAPQ-WQTFNGGNWEKVETSVRKFVADRNLTTDCYTGTWGVSTLPDVDGI 319
            |:   |...||...|::|| .:.||...|..:|...|: ||.:.:.:...||.   ..||.::| 
 Worm   159 QL---AVDQTFYLSNMSPQVGRGFNRDKWNDLEMHCRR-VAKKMINSYIITGP---LYLPKLEG- 215

  Fly   320 ERELYLDFDENNNGLIPVPKIYFRVVIDRVTREGIVLIGINNPYLTLEQIQKDYILCQDIGHQLS 384
            :.:.|:.:....:..:.||..:|:|.:..||.....|              :.|||...:     
 Worm   216 DGKKYIKYQVIGDNNVAVPTHFFKVALFEVTPGKFEL--------------ESYILPNAV----- 261

  Fly   385 WLTWYKEDLHEGYSYACSVEDFIEVVK-DLPLEDLHTNGILGLDDVTTVEPST 436
                              :||.:|:.| .:||:.:..:.  ||:....::|.:
 Worm   262 ------------------IEDTVEISKFHVPLDAVERSA--GLEIFARLDPKS 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG14120NP_648610.1 NUC 164..416 CDD:238043 55/260 (21%)
NUC 718..967 CDD:294067
NUC 1111..1359 CDD:238043
cps-6NP_491371.1 NUC1 10..308 CDD:224777 65/313 (21%)
NUC 83..293 CDD:214683 60/301 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.