DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wbp2 and AT5G11680

DIOPT Version :9

Sequence 1:NP_648607.3 Gene:Wbp2 / 39460 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_196729.1 Gene:AT5G11680 / 831040 AraportID:AT5G11680 Length:207 Species:Arabidopsis thaliana


Alignment Length:171 Identity:45/171 - (26%)
Similarity:68/171 - (39%) Gaps:30/171 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVNTAHANNGVLI-HAGEYILLHSDSVSMEFSGQDNPIFKGSKGGR------IYLTSHRMIFNS 58
            |::|.....||:.: ...|..:|..|.|  ||.....|   |..||.      |||::.||:|.|
plant     1 MALNPQLLPNGMPVPFVNEMFVLVRDGV--EFEVDKIP---GGHGGHVKAKGVIYLSNIRMVFVS 60

  Fly    59 KKSSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVR-AQPNGNY---VGEVKFKLHFKAGG--- 116
            .|..|:..:|..|.:.:...:..||:|..|.|.|:|. ..|...:   .....||:.||.||   
plant    61 SKPVDNFVAFDMPLLYIHAEKFNQPIFHCNNIAGQVEPVVPENEHRALYSTHSFKILFKEGGCGT 125

  Fly   117 -----------AIEYGQALLRSAKTAMNNYHRGGLAGDDPP 146
                       ..:|.:.:.::|:.|....|...|.....|
plant   126 FVPLFLNLISSVRQYNRQMQQAAEAAAAAPHVDPLQAAQTP 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 33/125 (26%)
AT5G11680NP_196729.1 PH-GRAM_WBP2 29..135 CDD:275401 31/108 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002589
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_103038
Panther 1 1.100 - - LDO PTHR31606
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.