DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wbp2 and wbp2

DIOPT Version :9

Sequence 1:NP_648607.3 Gene:Wbp2 / 39460 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001018380.2 Gene:wbp2 / 553565 ZFINID:ZDB-GENE-050522-137 Length:264 Species:Danio rerio


Alignment Length:286 Identity:105/286 - (36%)
Similarity:135/286 - (47%) Gaps:63/286 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVNTAHANNG-VLIHAGEYILLHSDSVSMEFSGQDN--PIFKGSKGGRIYLTSHRMIFNSKKSS 62
            |::|..|..:| |:|:..|.:|:..::|.:.||..:.  ..|:.||.|.||||.:|:||.: |..
Zfish     1 MALNKNHDESGRVIINNFEGVLMSYENVELVFSDSERLPDAFRKSKKGSIYLTPYRVIFLT-KGK 64

  Fly    63 DSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALLRS 127
            |.:|||..||..:...|::|||.|||||||.|.|:..|.:.|...|||.|.||||||:||.:|..
Zfish    65 DPLQSFMMPFYLMKGCEVKQPVLGANYIKGTVGAESGGGWEGSATFKLIFSAGGAIEFGQRMLHV 129

  Fly   128 AKTAMNN----------YHRGGLAGDDPPP----YQPAGSWNEAPPPAY----QPPPGYYGWLPQ 174
            |:.|...          |...|.....|||    ..|||    .|||.|    .||||  |:.|.
Zfish   130 AEQASRGQPVTVNFGCPYMANGAYAFPPPPPANGMYPAG----PPPPGYAYPGPPPPG--GFYPS 188

  Fly   175 HDAFSGPAPNTVYMSDNPPPYPGIAPPAHQPA-PQQPQ-----------APSSNEPNWYGFSAPP 227
            ...|.|||   .||.  ||||  .||..|.|. |..|:           |.||:....|   ||.
Zfish   189 PPVFDGPA---AYMP--PPPY--TAPVDHAPLDPDLPRTAAAEAKAAEAAASSSANTTY---APT 243

  Fly   228 PQQQQQQPGYGPQGWAGGYVQPPPYA 253
            ..       |.|:.      :||||:
Zfish   244 HV-------YLPED------KPPPYS 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 49/103 (48%)
wbp2NP_001018380.2 PH-GRAM_WBP2 30..131 CDD:275401 48/101 (48%)
WWbp 100..>164 CDD:287338 22/63 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575717
Domainoid 1 1.000 88 1.000 Domainoid score I7907
eggNOG 1 0.900 - - E1_KOG3294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 131 1.000 Inparanoid score I4609
OMA 1 1.010 - - QHG45819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002589
OrthoInspector 1 1.000 - - otm25279
orthoMCL 1 0.900 - - OOG6_103038
Panther 1 1.100 - - O PTHR31606
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1809
SonicParanoid 1 1.000 - - X3867
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1514.790

Return to query results.
Submit another query.