DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wbp2 and SPAC29B12.11c

DIOPT Version :9

Sequence 1:NP_648607.3 Gene:Wbp2 / 39460 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_594988.1 Gene:SPAC29B12.11c / 2542813 PomBaseID:SPAC29B12.11c Length:174 Species:Schizosaccharomyces pombe


Alignment Length:121 Identity:37/121 - (30%)
Similarity:55/121 - (45%) Gaps:14/121 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 GRIYLTSHRMIFNSKKSSDSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFK 109
            |.:.||:.|:::.:|.:....:.|.:|...|.|.::.||.|||||..|.|...|||....|.:.|
pombe    50 GLLCLTNQRLVYIAKDTDCDFKDFQSPVANLKDTKLNQPFFGANYYSGTVMPVPNGGIPCEAEVK 114

  Fly   110 LHFKAGGAIEYGQALLRSAK--------------TAMNNYHRGGLAGDDPPPYQPA 151
            |.|..||...:.:|..|..:              ..:..|||...:.|.||.|:.|
pombe   115 LQFNEGGIFNFVEAWNRLIQRFQEVDSVSRVQHLDPLPPYHRPSSSQDQPPHYEEA 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 29/83 (35%)
SPAC29B12.11cNP_594988.1 PH-GRAM_WBP2 34..134 CDD:275401 29/83 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002589
OrthoInspector 1 1.000 - - oto100771
orthoMCL 1 0.900 - - OOG6_103038
Panther 1 1.100 - - LDO PTHR31606
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1809
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.840

Return to query results.
Submit another query.