DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wbp2 and wbp-2

DIOPT Version :9

Sequence 1:NP_648607.3 Gene:Wbp2 / 39460 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_495987.1 Gene:wbp-2 / 174477 WormBaseID:WBGene00008404 Length:235 Species:Caenorhabditis elegans


Alignment Length:260 Identity:94/260 - (36%)
Similarity:130/260 - (50%) Gaps:42/260 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVNTAHANN--GVLIHAGEYILLHSDSVSMEFSGQDNPIFKGSKGGRIYLTSHRMIFNSKKSSD 63
            ||:|||:..:  |||::.||.|::.:..|.|.....:|...:|.:.|.|||||||:|| .....|
 Worm     1 MSINTANTPDGLGVLLYNGETIVIFAQGVVMTLGTSENENLEGRRTGTIYLTSHRIIF-MPDPGD 64

  Fly    64 SMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALLRSA 128
            .::||..||.::.||.:.||:|||||:.|...|...|...||||:::.|..||.||:||:||::.
 Worm    65 WLKSFEIPFNSMQDVNLNQPIFGANYLCGIASAVQGGQMRGEVKWRMTFNRGGCIEFGQSLLQAV 129

  Fly   129 KTAMNNYHRGGLAGDDPPPYQ-PAGSWNEAPPPAYQPPP--GYYGWLPQHDAF-SGPAPNTVYMS 189
            :.|:.......     ||.|. |.|.:..|||..|||.|  |..|:.|..|:| ..|.|:.|:||
 Worm   130 ERAVRMRPENA-----PPAYSPPIGDFYSAPPAYYQPSPDQGPNGFNPTTDSFPDQPNPSRVFMS 189

  Fly   190 DNPPPYPGIAPPAHQPAPQQPQAPSSNEPNWYGFSAPPPQQQQQQPGYGPQGWAGGYVQPPPYAS 254
            ..|||||||.|.                      ..|.|.::...        ||.:..||.|.|
 Worm   190 SAPPPYPGIGPE----------------------RGPHPTEELHV--------AGQFEAPPAYGS 224

  Fly   255  254
             Worm   225  224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 44/101 (44%)
wbp-2NP_495987.1 PH-GRAM_WBP2 29..130 CDD:275401 44/101 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157385
Domainoid 1 1.000 83 1.000 Domainoid score I5347
eggNOG 1 0.900 - - E1_KOG3294
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H136690
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG45819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002589
OrthoInspector 1 1.000 - - otm14228
orthoMCL 1 0.900 - - OOG6_103038
Panther 1 1.100 - - O PTHR31606
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1809
SonicParanoid 1 1.000 - - X3867
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.740

Return to query results.
Submit another query.