DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Wbp2 and wbp2nl

DIOPT Version :9

Sequence 1:NP_648607.3 Gene:Wbp2 / 39460 FlyBaseID:FBgn0036318 Length:384 Species:Drosophila melanogaster
Sequence 2:NP_001107397.1 Gene:wbp2nl / 100135228 XenbaseID:XB-GENE-951203 Length:281 Species:Xenopus tropicalis


Alignment Length:399 Identity:133/399 - (33%)
Similarity:167/399 - (41%) Gaps:133/399 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSVNTAHANN-GVLIHAGEYILLHSDSVSMEFS--GQDNPIFKGSKGGRIYLTSHRMIFNSKKSS 62
            ||:|..|:.. |:::..||.:|.....|.:.||  .|.:..|||:|.|.::||.:|:||.| |..
 Frog     1 MSLNKNHSEGAGIIVSNGESVLRQCKDVELSFSDMSQKSEAFKGTKKGSLFLTPYRVIFLS-KGK 64

  Fly    63 DSMQSFSAPFVALSDVEIEQPVFGANYIKGKVRAQPNGNYVGEVKFKLHFKAGGAIEYGQALLRS 127
            |.|.||:.||..:....||||||.||||||.:.|:|.|.:||:..|||.|.:|||||:||.:.:.
 Frog    65 DPMMSFNMPFYLMKGCSIEQPVFSANYIKGSIGAEPEGGWVGQASFKLTFNSGGAIEFGQVMFKM 129

  Fly   128 AKTAMNNYHRGGLAGDDPPPYQPAGSWNEAPPPAYQPPPGYYGWLPQHDAFSGPAPNTVYMSDNP 192
            |..|                       :.|||    .|...||::|....:              
 Frog   130 ATCA-----------------------SRAPP----VPHAVYGYIPAPGGY-------------- 153

  Fly   193 PPYPGI--APPAHQPAPQQPQAPSSNEPNWYGFSAPPPQQQQQQPGYGPQGWAGGYVQPPPYASC 255
            ||.|||  |||  ||:...|..|.:  .|.||   |||         .|.|:.  |..||     
 Frog   154 PPAPGIYSAPP--QPSGPYPYGPPA--MNGYG---PPP---------NPMGYP--YAPPP----- 195

  Fly   256 APNCPPQPP-----YAAPAQTYNGPQPYGGYGNVPGGFNTPGFQQPNGNPNGYPGGPPPPGQQAA 315
            .|...|.||     |.||...|.|| ||                      ||.|....|.|...|
 Frog   196 GPGMYPPPPEMNPMYMAPPPPYPGP-PY----------------------NGTPAPSAPSGCMDA 237

  Fly   316 GAAGGAAASGASFMGFSLPPGNSKEAEAAASAYNTPYNQGGPSGSGNN-----DLPPSYNNLPPS 375
            |.                 ||.||.||||:|||   ||...|    :|     |.||.|   .|:
 Frog   238 GM-----------------PGGSKAAEAASSAY---YNPADP----HNVYMPMDRPPPY---APT 275

  Fly   376 YDDASKKNH 384
            .|   |||:
 Frog   276 DD---KKNN 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Wbp2NP_648607.3 PH-GRAM_WBP2 27..129 CDD:275401 50/103 (49%)
wbp2nlNP_001107397.1 PH-GRAM_WBP2 30..130 CDD:275401 49/100 (49%)
WWbp 100..>186 CDD:287338 42/142 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 100 1.000 Domainoid score I6907
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 147 1.000 Inparanoid score I4314
OMA 1 1.010 - - QHG45819
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002589
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR31606
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1809
SonicParanoid 1 1.000 - - X3867
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.100

Return to query results.
Submit another query.