DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10960 and SLC2A3

DIOPT Version :9

Sequence 1:NP_648605.1 Gene:CG10960 / 39458 FlyBaseID:FBgn0036316 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_008862.1 Gene:SLC2A3 / 6515 HGNCID:11007 Length:496 Species:Homo sapiens


Alignment Length:412 Identity:126/412 - (30%)
Similarity:207/412 - (50%) Gaps:34/412 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 TLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTML---IWAVNVSMLYASRFILGIAGGAFC 196
            ::|.......:|..:|..||:.:||.:.|..:.|...:   ..|.:|.||...|.::|:..|...
Human    71 SVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCT 135

  Fly   197 VTAPMYTGEIAQKEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIICG---ILPLIFG---- 254
            ...|||.|||:...:||..|:..||.|.:|||.       .:||.|..|.|   :.||:.|    
Human   136 GFVPMYIGEISPTALRGAFGTLNQLGIVVGILV-------AQIFGLEFILGSEELWPLLLGFTIL 193

  Fly   255 ------AIFFFMPESPTY-LVSKDRSENAIKSIQWLRGKEYDYEPELAELR-ETDRETKANKVNV 311
                  |...|.||||.: |:::...|||.:.:|.|.|.: |...::.|:: |:.|.::..:|.|
Human   194 PAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQ-DVSQDIQEMKDESARMSQEKQVTV 257

  Fly   312 WAALNRPVTRKALAISMGLMFFQQVCGINAVIFYASRIFLEANTGI-EAEWATILIGIMQVVATF 375
            .........|:.:.||:.|...||:.|||||.:|::.||.:|  |: |..:|||..|::..:.|.
Human   258 LELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDA--GVQEPIYATIGAGVVNTIFTV 320

  Fly   376 VSTLVVDKLGRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLGWLPVASLCLFIIMFSIGY 440
            ||..:|::.|||.|.:.....||..:|.:.|...|:.    ....:.::.:.::.:|:..|.||.
Human   321 VSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKD----NYNGMSFVCIGAILVFVAFFEIGP 381

  Fly   441 GPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGTFWLFAGLTVVGVIF 505
            ||:||.::.|||:...:..|.::||.|||...|:|...|.:....|| ...|.:|.|..:..:.|
Human   382 GPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLG-AYVFIIFTGFLITFLAF 445

  Fly   506 VYFAVPETKGKSLNEIQQELAG 527
            .:|.||||:|::..:|.:...|
Human   446 TFFKVPETRGRTFEDITRAFEG 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10960NP_648605.1 MFS_1 117..474 CDD:284993 109/357 (31%)
MFS 118..508 CDD:119392 118/391 (30%)
SLC2A3NP_008862.1 MFS_GLUT_Class1 12..456 CDD:340989 123/399 (31%)
Important for selectivity against fructose. /evidence=ECO:0000269|PubMed:26176916 277..279 0/1 (0%)
Monosaccharide binding. /evidence=ECO:0000269|PubMed:26176916 280..286 3/5 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143892
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X26
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.