DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10960 and CG8837

DIOPT Version :9

Sequence 1:NP_648605.1 Gene:CG10960 / 39458 FlyBaseID:FBgn0036316 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001285582.1 Gene:CG8837 / 33545 FlyBaseID:FBgn0031520 Length:485 Species:Drosophila melanogaster


Alignment Length:474 Identity:126/474 - (26%)
Similarity:217/474 - (45%) Gaps:45/474 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 PQYVAALAAAGGAFAAGTVLGWT-------SPAETEIVDRGE--GYDFPVDKDQFSWVGSAMTLG 137
            |:.|...|....|.|.|.:|.:.       :||...:.:..|  ..:...|....:|:...:.|.
  Fly     4 PKRVGGPAIQSVATALGNILCFNFGLMFGITPAHMTLYESEERTPLNQATDPAGTAWLTGYLFLS 68

  Fly   138 AACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFILGIAGGAFCVTAPMY 202
            ||...:..|||...||.|..:|...|..|.||..:.:..::..:||||...|:|.||..|..|::
  Fly    69 AALGALVSGFLALKIGPKSVLLCSGLLQISGWACIHFGYDIVHIYASRLFAGVASGAAFVVLPIF 133

  Fly   203 TGEIAQ-KEIRGTLGSFFQLMITIGILFVYAVGAGVKIFWLSIICGILPLIFGAIFFFMPESPTY 266
            ..|||: :|....|....:|..|:|||..:.:|..|...:::|:...:..:|...|.|:.|||.|
  Fly   134 INEIAESREKAARLTFTIELWRTLGILIGFVLGFYVPYAFVNIVGCAVSFVFTMTFPFVQESPHY 198

  Fly   267 LVSKDRSENAIKSIQWLRG-KEYD--YEPE-LAELRETDRETKANKVNVWAALNRPVTRKALAIS 327
            .:.|:...:..||::|.|| ::.|  .:|| |:||.|...|.::...||.:.   |::...:...
  Fly   199 YLRKNNMASLEKSLRWYRGIRDIDDREKPEYLSELNEFHAELRSRDKNVGST---PMSHGYIIRL 260

  Fly   328 MGLMFFQQVCGINAVIFYASRIFLEAN--------TGIEAEWATILIGIMQVVATFVSTLVVDKL 384
            ..:.|...||.      ..|.:|:|.|        ||...|...:::...|.....::.||..:|
  Fly   261 TFVSFLLTVCA------KLSGVFVELNYAADFLGRTGYSTETNYVVLASAQCAGALLARLVGPRL 319

  Fly   385 GRRILLLASGISMAISTTAIGVYFFLQKQDAAQVVSLG-----WLPVASLCLFIIMFSIGYGPVP 444
            .|::||..|.:..|.:..|:.::     :....:..||     :||:..|.:.:.:.|.|..|:.
  Fly   320 PRKLLLCLSSLFAAAAVIALALF-----KAYGHLWLLGNWADRYLPIILLAIQLALVSFGLYPLA 379

  Fly   445 WLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTF--VNLNDGLGIGGTFWLFAGLTV-VGVIFV 506
            .::..|:..|.:.....|||...:|||.|.:.:.|  |......|:....|:|||.:: ||:|.:
  Fly   380 AVVSSEVLPTKLHDLLYSLASAVSWLLLFGMIEAFNAVKATIAPGLLLYLWVFAGASIFVGLISL 444

  Fly   507 YFAVPETKGKSLNEIQQEL 525
            .. :|||:.:..:.:|:||
  Fly   445 PL-LPETRNRRPSAVQREL 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10960NP_648605.1 MFS_1 117..474 CDD:284993 99/374 (26%)
MFS 118..508 CDD:119392 110/410 (27%)
CG8837NP_001285582.1 MFS 54..>192 CDD:119392 41/137 (30%)
Sugar_tr 58..453 CDD:278511 112/409 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45444278
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.