powered by:
Protein Alignment CG10960 and K09C4.2
DIOPT Version :9
Sequence 1: | NP_648605.1 |
Gene: | CG10960 / 39458 |
FlyBaseID: | FBgn0036316 |
Length: | 539 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001361999.1 |
Gene: | K09C4.2 / 187193 |
WormBaseID: | WBGene00019548 |
Length: | 152 |
Species: | Caenorhabditis elegans |
Alignment Length: | 65 |
Identity: | 19/65 - (29%) |
Similarity: | 31/65 - (47%) |
Gaps: | 8/65 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 130 VGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFILGIAGGA 194
||.||..|:..|.:|:..|..:|...::.:|.| ||::..| |..:|..|::....|.|
Worm 34 VGQAMLFGSMAVGMPVVSLFPIINSIFSPIFFV-PFVIVQT-------VFGIYLYRYMPETRGRA 90
Fly 195 194
Worm 91 90
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C160157924 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D524131at33208 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.850 |
|
Return to query results.
Submit another query.