DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10960 and K09C4.2

DIOPT Version :9

Sequence 1:NP_648605.1 Gene:CG10960 / 39458 FlyBaseID:FBgn0036316 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_001361999.1 Gene:K09C4.2 / 187193 WormBaseID:WBGene00019548 Length:152 Species:Caenorhabditis elegans


Alignment Length:65 Identity:19/65 - (29%)
Similarity:31/65 - (47%) Gaps:8/65 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   130 VGSAMTLGAACVCIPIGFLINMIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFILGIAGGA 194
            ||.||..|:..|.:|:..|..:|...::.:|.| ||::..|       |..:|..|::....|.|
 Worm    34 VGQAMLFGSMAVGMPVVSLFPIINSIFSPIFFV-PFVIVQT-------VFGIYLYRYMPETRGRA 90

  Fly   195  194
             Worm    91  90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10960NP_648605.1 MFS_1 117..474 CDD:284993 19/65 (29%)
MFS 118..508 CDD:119392 19/65 (29%)
K09C4.2NP_001361999.1 MFS <11..89 CDD:391944 17/62 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160157924
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.