DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10960 and SLC2A13

DIOPT Version :9

Sequence 1:NP_648605.1 Gene:CG10960 / 39458 FlyBaseID:FBgn0036316 Length:539 Species:Drosophila melanogaster
Sequence 2:NP_443117.3 Gene:SLC2A13 / 114134 HGNCID:15956 Length:648 Species:Homo sapiens


Alignment Length:551 Identity:142/551 - (25%)
Similarity:230/551 - (41%) Gaps:125/551 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    84 YVAALAAAGGAFAAGTVLGWTSPAETEIVDRGEGYDFPVDKDQFS----W----VGSAMTLGAAC 140
            ||.|:.:|.|.|..|...|..|.|...:            |.|.|    |    |.|  |:|||.
Human    82 YVVAVFSALGGFLFGYDTGVVSGAMLLL------------KRQLSLDALWQELLVSS--TVGAAA 132

  Fly   141 VCIPIGFLIN-MIGRKWTMLFLVLPFILGWTMLIWAVNVSMLYASRFILGIAGGAFCVTAPMYTG 204
            |....|..:| :.||:..:|.....|..|..:|..|.|...|.|.|.::|:..|...:|.|:|..
Human   133 VSALAGGALNGVFGRRAAILLASALFTAGSAVLAAANNKETLLAGRLVVGLGIGIASMTVPVYIA 197

  Fly   205 EIAQKEIRGTLGSFFQLMITIGILFVYAVGAGV----KIFW-----LSIICGILPLIFGAIFFFM 260
            |::...:||.|.:...|.||.|..|...|....    |..|     |:.:..::. .||  |.|:
Human   198 EVSPPNLRGRLVTINTLFITGGQFFASVVDGAFSYLQKDGWRYMLGLAAVPAVIQ-FFG--FLFL 259

  Fly   261 PESPTYLVSKDRSENAIKSIQWLRGK---EYDYEPELAELRETDRETKANKVNVWAALNRPVTRK 322
            ||||.:|:.|.:::.|.:.:..:||.   :.:|:.....:.|.::|..:....:...|:.|.||:
Human   260 PESPRWLIQKGQTQKARRILSQMRGNQTIDEEYDSIKNNIEEEEKEVGSAGPVICRMLSYPPTRR 324

  Fly   323 ALAISMGLMFFQQVCGINAVIFYASRIFLEANTGIEAEWATILIGIMQVVATFVSTLV----VDK 383
            ||.:..||..|||:.|||.:::|::.|.  ..:|:|.:...|.:..:.....|:.|||    |:|
Human   325 ALIVGCGLQMFQQLSGINTIMYYSATIL--QMSGVEDDRLAIWLASVTAFTNFIFTLVGVWLVEK 387

  Fly   384 LGRRILLLAS--GISMAISTTAIGVYF-------------------------------------- 408
            :|||.|...|  |.::|:...|:|...                                      
Human   388 VGRRKLTFGSLAGTTVALIILALGFVLSAQVSPRITFKPIAPSGQNATCTRYSYCNECMLDPDCG 452

  Fly   409 FLQKQDAAQVVS----------------------------------------LGWLPVASLCLFI 433
            |..|.:.:.|:.                                        ..|..:..|.|::
Human   453 FCYKMNKSTVIDSSCVPVNKASTNEAAWGRCENETKFKTEDIFWAYNFCPTPYSWTALLGLILYL 517

  Fly   434 IMFSIGYGPVPWLMMGELFATDIKGFAGSLAGTSNWLLAFVVTKTFVNLNDGLGIGGTFWLFAGL 498
            :.|:.|.||:||.:..|::....:....:.:...||:...:|:.||::..:.|...|.|:|:||.
Human   518 VFFAPGMGPMPWTVNSEIYPLWARSTGNACSSGINWIFNVLVSLTFLHTAEYLTYYGAFFLYAGF 582

  Fly   499 TVVGVIFVYFAVPETKGKSLNEIQQELAGNR 529
            ..||::|:|..:||||||.|.|| :.|..||
Human   583 AAVGLLFIYGCLPETKGKKLEEI-ESLFDNR 612

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10960NP_648605.1 MFS_1 117..474 CDD:284993 107/461 (23%)
MFS 118..508 CDD:119392 119/494 (24%)
SLC2A13NP_443117.3 Sugar_tr 84..609 CDD:278511 137/544 (25%)
MFS 86..591 CDD:119392 126/523 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143907
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0254
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D524131at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.