DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg1 and Ulk3

DIOPT Version :9

Sequence 1:NP_001163433.1 Gene:Atg1 / 39454 FlyBaseID:FBgn0260945 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_082171.1 Gene:Ulk3 / 71742 MGIID:1918992 Length:472 Species:Mus musculus


Alignment Length:429 Identity:138/429 - (32%)
Similarity:212/429 - (49%) Gaps:46/429 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 DMLGHGAFAVVYKGRHRK-KHMPVAIKCITKK--GQLKTQNLLGKEIKILKELTELHHENVVALL 74
            :.||.|.:|.|||...:| ....|||||:.||  .:...:||| .||:|||   .:.|.::|.|.
Mouse    18 ERLGSGTYATVYKAYAKKDTREVVAIKCVAKKSLNKASVENLL-TEIEILK---GIRHPHIVQLK 78

  Fly    75 DCKESQDCVSLVMEYCNGGDLADYLSVKGTLSEDTVRLFLVQLAGAMKALYTKGIVHRDLKPQNI 139
            |.:...|.:.|:||:|.||||:.::..:..|.|...|:|:.|||.|::.|:.:.|.|.|||||||
Mouse    79 DFQWDNDNIYLIMEFCAGGDLSRFIHTRRILPEKVARVFMQQLASALQFLHERNISHLDLKPQNI 143

  Fly   140 LLSHNYGKTLPAPSKITLKIADFGFARFLNEGAMAATLCGSPMYMAPEVIMSLQYDSKADLWSLG 204
            |||     :|..|.   ||:||||||:.::.......|.|||:|||||::...|||::.||||:|
Mouse   144 LLS-----SLEKPH---LKLADFGFAQHMSPWDEKHVLRGSPLYMAPEMVCRRQYDARVDLWSVG 200

  Fly   205 TIVYQCLTGKAPFYAQTPNELKSYYEQNANLAPKIPSGVSPDLRDLLLCLLRRNSKDRISYESFF 269
            .|:|:.|.|:.||.:::.:||:.....|..:...:...:|.|.||||..||.|:...|||::.||
Mouse   201 VILYEALFGQPPFASRSFSELEEKIRSNRVIELPLRPQLSLDCRDLLQRLLERDPARRISFKDFF 265

  Fly   270 VHRFL------------QGKKAAVSPGEPSQAANLRRRVS-KSGVLPVDMPPLGGTPPAKAKSPL 321
            .|.::            |.:...|...:..|..:....:| ....|...:|.|.....|:.|..:
Mouse   266 AHPWVDLEHMPSGESLAQARALVVEAVKKDQEGDAAAALSLYCKALDFFVPALHYEVDAQRKEAI 330

  Fly   322 QQQLEQ------ELKLVKLAEQQQKEREEQEAQEDENTVSVVA--NPAICATITNVGVLCDSENN 378
            :.::.|      |||.:..:..|...|:....||   .:..:|  .|.:.|.:.........|..
Mouse   331 KAKVGQYVSRAEELKAIVSSSNQALLRQGTTVQE---LLREMARDKPRLLAALEVASAALAKEEE 392

  Fly   379 SG------SCSSHEDSDDFVLVPKNLPEDQRQGL-AQVQ 410
            :|      ....|...:..||:....|..:|:.| .:||
Mouse   393 AGKEQDALDLYQHSLGELLVLLAAEAPGRRRELLHTEVQ 431

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg1NP_001163433.1 S_TKc 9..274 CDD:214567 108/263 (41%)
STKc_ULK1_2-like 15..273 CDD:271022 108/260 (42%)
DUF3543 638..844 CDD:288883
Ulk3NP_082171.1 S_TKc 14..270 CDD:214567 108/263 (41%)
STKc_ULK3 18..269 CDD:271023 108/262 (41%)
MIT_2 279..353 CDD:239147 13/73 (18%)
MIT 374..449 CDD:239121 12/58 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1084750at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5656
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.