DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Atg1 and stk35

DIOPT Version :9

Sequence 1:NP_001163433.1 Gene:Atg1 / 39454 FlyBaseID:FBgn0260945 Length:855 Species:Drosophila melanogaster
Sequence 2:NP_001071084.1 Gene:stk35 / 568080 ZFINID:ZDB-GENE-061103-553 Length:406 Species:Danio rerio


Alignment Length:334 Identity:97/334 - (29%)
Similarity:138/334 - (41%) Gaps:95/334 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YSSKDMLGHGAFAVVYKGRHRKKHMPVAIKCITKKGQLKTQNLLGKEIKILKELTELHHENVVAL 73
            ||....:|.|::.|||:...|:....||||.:......|.:..|. |...|..| |..|||||.|
Zfish    71 YSLIREVGRGSYGVVYEAVARRSGARVAIKKLRCDAPEKVELALA-EFWALASL-EKRHENVVQL 133

  Fly    74 LDC---------------KESQDCVSL----------------------VMEYCNGGDLADYLSV 101
            .:|               |.::..:.|                      |||:|:||||..|:  
Zfish   134 EECVLQRNGMAQKMSHGNKRNKQYLRLVETSLKGERILGYPEEPCYLWFVMEFCDGGDLNQYI-- 196

  Fly   102 KGTLSE----DTVRLFLVQLAGAMKALYTKGIVHRDLKPQNILLSHNYGKTLPAPSKITLKIADF 162
               ||.    .|.|.|:.||..|:..|:...||||||||.|||:|...|..:       :|:|||
Zfish   197 ---LSRRPDPRTNRSFMKQLTSAVAFLHKNNIVHRDLKPDNILISQKSGNPV-------IKVADF 251

  Fly   163 GFAR-------FLNEG--------------AMAATLCGSPMYMAPEVIMSLQYDSKADLWSLGTI 206
            |.::       ..|||              ...::.|||..|||||| ....|.:|||:::||.|
Zfish   252 GLSKVCAGLSCMQNEGDDQVNNKNIVNINKFWLSSACGSDFYMAPEV-WEGHYTAKADIFALGII 315

  Fly   207 VYQCLTGKAPFYAQTPNE-LKSYYEQNANLAP-----------------KIPSGVSPDLRDLLLC 253
            ::..:.......|::..| |.:|..|...:.|                 |..|.:|..::.||..
Zfish   316 IWAMIERITFIDAESKRELLGTYVRQGTEIVPVGEALLENPKMVLHIPQKTRSIMSEGVKRLLQD 380

  Fly   254 LLRRNSKDR 262
            :|..|.:||
Zfish   381 MLAVNPQDR 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Atg1NP_001163433.1 S_TKc 9..274 CDD:214567 97/334 (29%)
STKc_ULK1_2-like 15..273 CDD:271022 95/328 (29%)
DUF3543 638..844 CDD:288883
stk35NP_001071084.1 PKc_like 70..401 CDD:304357 97/334 (29%)
S_TKc 71..395 CDD:214567 97/334 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0595
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.